KEGG   Saccharomyces cerevisiae (budding yeast): YHR002W
Entry
YHR002W           CDS       T00005                                 

Gene name
LEU5
Definition
(RefSeq) coenzyme A transporter
  KO
K15084  solute carrier family 25 (mitochondrial carrier protein), member 16
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YHR002W (LEU5)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YHR002W (LEU5)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 856391
NCBI-ProteinID: NP_011865
SGD: S000001044
UniProt: P38702
Position
VIII:108812..109885
AA seq 357 aa
MTRDSPDSNDSYKHINKNTTQKTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKIL
FQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYEQIR
NTLIPSKEFESHWRRLVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYK
EPASATLIKNDYIPNWFCHWCNFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPY
SVLELSEDDELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPK
TMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMKWNFGI
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgacgcgagatagcccagattctaacgacagctataagcatataaacaagaatactaca
caaaaaacctcgtttgatagaaattcattcgattatattgtacgatcgggattagctgga
ggtatatcaggttcatgtgcgaaaacactaatcgcacccttagatagaataaaaatttta
tttcaaacatcaaatccgcactacacaaagtacacaggctcactaataggattagtagag
gcagccaagcatatatggatcaatgatggggtaagggggttttttcaaggccattcagca
acccttttaaggatttttccatatgctgctgtcaaatttgttgcttatgaacagattagg
aataccttgattccctcaaaagaatttgagtcacattggagaaggttggtgagtggttca
ctggcaggattatgcagtgttttcataacatatccgttagatctcgtgagggttaggtta
gcatatgaaacagaacataagagagtaaagctaggaagaataatcaagaaaatatataag
gaaccagcttcagccacgctaatcaaaaatgattatattcctaactggttttgtcattgg
tgtaatttttataggggttatgttccaactgtacttggcatgataccatatgcaggtgtt
tccttttttgctcacgatttacttcatgatgtgctgaagagtcctttctttgccccttat
tcagtattagaactttcagaagatgatgaattggaaagagtacagaaaaagcagagaagg
cctttgcgtacgtgggctgaattgatctctggtggtctagctggtatggcctcccaaacg
gcagcatatccatttgaaattattaggagaaggctccaagtaagtgcactgtcaccaaaa
actatgtatgatcataaatttcaatcgatatctgaaattgctcacataatatttaaagaa
cgtggagtacgtggattttttgttggtctaagcataggttatattaaagtaacacctatg
gttgcatgtagttttttcgtctatgaaagaatgaaatggaattttggcatttaa

DBGET integrated database retrieval system