KEGG   Saccharomyces cerevisiae (budding yeast): YHR005C-A
Entry
YHR005C-A         CDS       T00005                                 

Gene name
TIM10, MRS11
Definition
(RefSeq) protein transporter TIM10
  KO
K17778  mitochondrial import inner membrane translocase subunit TIM10
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sce03029]
    YHR005C-A (TIM10)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YHR005C-A (TIM10)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Transporter inner membrane (TIM) 9/10 complex
    YHR005C-A (TIM10)
Transporters [BR:sce02000]
 Other transporters
  Primary active transporters [TC:3]
   YHR005C-A (TIM10)
SSDB
Motif
Pfam: zf-Tim10_DDP
Other DBs
NCBI-GeneID: 856395
NCBI-ProteinID: NP_011869
SGD: S000003530
UniProt: P87108
Structure
PDB: 
3DXR

Position
VIII:complement(115620..115901)
AA seq 93 aa
MSFLGFGGGQPQLSSQQKIQAAEAELDLVTDMFNKLVNNCYKKCINTSYSEGELNKNESS
CLDRCVAKYFETNVQVGENMQKMGQSFNAAGKF
NT seq 282 nt   +upstreamnt  +downstreamnt
atgtctttcttaggtttcggtggtggtcagcctcaattatcatctcaacaaaagattcaa
gctgcggaagctgaactagatttggtcacagacatgttcaataaattggttaataactgt
tataaaaaatgtatcaatacttcttattccgagggtgagctgaataagaatgaatcttcg
tgcctagacagatgtgtggccaaatattttgagaccaatgttcaagtcggtgaaaacatg
cagaaaatgggccaatcatttaacgcagccggtaagttttag

DBGET integrated database retrieval system