KEGG   Saccharomyces cerevisiae (budding yeast): YHR012W
Entry
YHR012W           CDS       T00005                                 

Gene name
VPS29, PEP11, VPT6
Definition
(RefSeq) retromer subunit VPS29
  KO
K18467  vacuolar protein sorting-associated protein 29
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YHR012W (VPS29)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YHR012W (VPS29)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    YHR012W (VPS29)
SSDB
Motif
Pfam: Metallophos_2
Other DBs
NCBI-GeneID: 856403
NCBI-ProteinID: NP_011876
SGD: S000001054
UniProt: P38759
Position
VIII:join(129481..129528,129648..130448)
AA seq 282 aa
MLLLALSDAHIPDRATDLPVKFKKLLSVPDKISQVALLGNSTKSYDFLKFVNQISNNITI
VRGEFDNGHLPSTKKDKASDNSRPMEEIPMNSIIRQGALKIGCCSGYTVVPKNDPLSLLA
LARQLDVDILLWGGTHNVEAYTLEGKFFVNPGSCTGAFNTDWPIVFDVEDSDEAVTSEVD
KPTKENQSEDDDAKGGSTGKEQPGSYTPKEGTAGERENENESNVKPENQFKEDEVDMSDS
DINGSNSPSFCLLDIQGNTCTLYIYLYVNGEVKVDKVVYEKE
NT seq 849 nt   +upstreamnt  +downstreamnt
atgttgttgttagcattaagtgatgcacatattcctgatagagcaactgatttacctgta
aaattcaaaaaattactaagcgttcctgataaaatatctcaggtcgctttattaggtaat
agtacaaagtcttatgactttttgaaatttgtcaatcagatatctaacaatataacaatc
gtaagaggagaatttgataatgggcacttaccaagcacgaagaaagataaagcatcagat
aactctagaccgatggaagaaattcctatgaatagtataataaggcaaggtgctttgaaa
atcggctgttgtagcggttataccgttgtgccaaagaacgaccccttatctttgttagca
ttggcacgccagttggatgtagacattttattgtggggtggtactcataacgttgaagct
tataccttagagggaaaatttttcgttaatccaggtagctgtacgggtgcttttaataca
gattggccaattgtctttgatgttgaggatagcgatgaagctgtgacatcagaggtggac
aagccgactaaggagaatcagtcggaggatgacgatgccaagggtggatcaacaggaaag
gaacaacctgggtcttacacgcctaaagaaggcactgctggggaacgtgagaatgagaat
gaaagcaacgttaagcctgaaaaccaatttaaggaagacgaggttgatatgtcagattcg
gatataaatgggtctaattcaccaagtttctgcctcttggatattcaaggcaatacctgc
acgttatacatttatttatacgttaatggagaagtgaaggtcgataaagtggtttatgaa
aaggaatag

DBGET integrated database retrieval system