KEGG   Saccharomyces cerevisiae (budding yeast): YHR020W
Entry
YHR020W           CDS       T00005                                 
Name
(RefSeq) proline--tRNA ligase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YHR020W
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sce01007]
    YHR020W
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sce03016]
    YHR020W
Enzymes [BR:sce01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     YHR020W
Amino acid related enzymes [BR:sce01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   YHR020W
Transfer RNA biogenesis [BR:sce03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    YHR020W
 Prokaryotic type
    YHR020W
SSDB
Motif
Pfam: ProRS-C_1 HGTP_anticodon tRNA-synt_2b tRNA_edit
Other DBs
NCBI-GeneID: 856413
NCBI-ProteinID: NP_011884
SGD: S000001062
UniProt: P38708
Position
VIII:143996..146062
AA seq 688 aa
MPVSEAFAKLCVNEKPPAESAVAVKSLVFKPKTPKSATPVPIVVVALQSTTTPSALIANA
TSSKDPRLARDDLVKQAFQSESARAFILGDLANATSNFHLLIDHELGTVDGDTILQLNDS
TYMKKSDMMKFLNNFEDSQKVVDFSQEVSKETATEGKKQQKKQQPSKAGTAAAAAAAALE
DAKLIGITVDKALDFPGWYQQILTKGEMLDYYDVSGCYILRPPSYAIWENIQKWFDDKIK
AIGVQNAYFPMFVSSRVLEKEKDHVEGFAPEVAWVTRAGSSELEEPIAIRPTSETVMYPY
YAKWVQSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAHLTAKDAEEEVLQI
LDFYAGVYEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQTGRGIQGATSHHLGQNFS
KMFNLSVENPLGSDHPKIFAYQNSWGLSTRVIGVMVMIHSDNKGLVIPPRVSQFQSVVIP
VGITKKTSEEQRKHIHETARSVESRLKKVGIRAFGDYNDNYTPGWKFSQYELKGIPIRIE
LGPKDIEKNQVVVVRRNDSKKYVVSFDELEARIPEILEEMQGDLFKKAKELFDTHRVIVN
EWSGFVPALNKKNVILAPWCGVMECEEDIKESSAKKDDGEEFEEDDKAPSMGAKSLCIPF
DQPVLNEGQKCIKCERIAVNYCMFGRSY
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgcctgtttcggaagcgtttgccaagttgtgtgtgaatgagaagcctcctgctgaatct
gccgttgcggtgaagtctttggtcttcaaaccaaagactccaaagtccgccacccctgtt
cctatcgttgtggtggctttgcaatctactactactccttctgcgttgattgccaacgct
acgtccagtaaggatccaagattggctcgcgatgatttggtcaagcaagcgttccaatct
gaatccgctagagcttttatcttgggggatttggctaacgccacgtccaattttcacttg
ctaattgatcacgagttgggtactgttgacggtgacactatcttgcagttaaacgacagt
acttatatgaagaaatctgacatgatgaaatttctaaacaattttgaggatagtcaaaaa
gtggttgatttctcccaagaggtgtctaaggaaaccgctacagaaggcaagaaacaacag
aaaaagcagcaaccttctaaggcaggcactgcagcagcagcagcagcagcagctttggaa
gacgccaaacttattggtatcaccgtagacaaagcgttggatttcccaggctggtaccaa
caaatcttgaccaagggtgaaatgttggactactacgatgtttctggctgttacatctta
agacctccttcttatgcgatctgggaaaacattcagaaatggttcgacgacaagatcaag
gccattggtgtacaaaatgcctatttcccaatgtttgtttcctcacgtgtgttggaaaag
gaaaaggaccatgttgaaggctttgctccagaagttgcctgggtcaccagagctggctcc
tctgaattggaagaaccaatcgccattagaccaacttctgaaactgtcatgtatccttac
tacgcaaaatgggtccagtcttacagagatttaccattgaaactaaaccaatggaattct
gtggttagatgggaattcaagcatcctcagccctttttaagaaccagagaattcttgtgg
caagaaggtcatactgctcacttgactgctaaggatgccgaagaggaggttttgcaaatc
ttagatttctacgctggggtttacgaagagttattagctgttccagtggttaagggtaga
aagaccgaaaaggaaaaatttgctggtggtgacttcaccacaacttgtgaaggctatatt
ccacaaaccggtcgtggtattcaaggtgccacctctcaccatttgggccaaaacttttct
aagatgttcaatttgtctgtggagaacccactaggttctgatcatccaaagatctttgcg
taccaaaattcatggggtttatccactcgtgtcattggtgtcatggtcatgatccactct
gacaacaagggtttggttatcccaccaagagtgtcccaattccaatccgttgtcattcca
gtgggcatcacaaagaagacctctgaggaacagcgtaaacacattcatgaaacagccaga
agtgtggaatcccgtttgaaaaaggttggcattagagcctttggtgactataacgataat
tacacaccaggttggaaattttcccaatacgagctaaagggtattccaatccgtattgaa
ttaggtcctaaggatattgaaaaaaaccaagtcgttgtcgttcgtagaaatgactccaag
aaatacgtcgtttctttcgacgaattggaagcccgtatcccagaaatcttagaagaaatg
caaggagatttgttcaaaaaagccaaggagctattcgacacccacagagttatcgttaat
gaatggagtggttttgttccagcattgaacaagaagaacgttatcttagcaccatggtgt
ggtgtgatggaatgtgaagaagatatcaaggaatcttctgcaaagaaagacgatggtgaa
gaattcgaggaagatgacaaggcaccaagtatgggtgccaaatctttatgtatcccattc
gaccaacctgtattgaatgaaggtcaaaaatgtatcaagtgtgaacgtattgctgtcaat
tactgtatgttcggtcgttcttattag

DBGET integrated database retrieval system