KEGG   Saccharomyces cerevisiae (budding yeast): YHR022C
Entry
YHR022C           CDS       T00005                                 

Definition
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Ras Roc GTP_EFTU ATP_bind_1 MMR_HSR1 SRPRB
Other DBs
NCBI-GeneID: 856417
NCBI-ProteinID: NP_011887
SGD: S000001064
UniProt: P38763
Position
VIII:complement(149575..150345)
AA seq 256 aa
MSVRLSYGASLASIPRCFDLKSSKITVMGDDHSGKTSLVRSWLGSSFQISDANRYRVSDL
YHKTIQFDTLVKYYRTFGVKGQLPNYAGFKAKNSGTIYESCGNFLEERLINANKSTAQRR
TSIDVQVFDTNQMEVSYLSELTTLQIRQSDAIILCFDSTNDSSLASLESYICIIHHVRLE
CELDIPIIIACTKCDLDSERTITHEKVLTFIQELGFSPGNLDYFETSSKFNVNVEDLFLA
VLLKIEKSKSDRRKLL
NT seq 771 nt   +upstreamnt  +downstreamnt
atgagtgttcgcttatcatacggcgcaagccttgcgtcaatcccaagatgtttcgacttg
aaatcttcgaagattactgtaatgggggatgatcattctggaaaaacttctctggttcgc
agttggctaggtagttcatttcaaatatcagatgctaatcgttatagggtttcggacctc
taccacaagacaatccaatttgatactttggtaaaatactatcgtacctttggcgtaaaa
ggacagttgccgaattatgcgggtttcaaagctaaaaactctggcacaatttatgaaagt
tgtggcaatttcctagaagagcgcctgatcaatgccaataaatcgactgctcaaagacgc
accagtattgatgttcaagtttttgataccaatcaaatggaggtttcgtacctttcggag
ctaactactcttcaaattaggcagtctgatgcaattatattatgtttcgattctactaat
gacagctctcttgccagcttagagtcttatatttgtattattcaccacgtacgtttggaa
tgtgaattggatattccaattattatagcgtgtacgaaatgtgatcttgattcggaaaga
acaattactcatgaaaaggttttaacatttatccaagagctgggtttctcgccaggcaat
ttagactattttgagacatcctccaagttcaatgtaaatgttgaagatttgttcttggca
gtattattgaaaattgaaaaatctaaaagtgatcgcaggaaacttttgtaa

DBGET integrated database retrieval system