KEGG   Saccharomyces cerevisiae (budding yeast): YHR026W
Entry
YHR026W           CDS       T00005                                 

Symbol
VMA16, PPA1
Name
(RefSeq) H(+)-transporting V0 sector ATPase subunit c''
  KO
K03661  V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
sce04145  Phagosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YHR026W (VMA16)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    YHR026W (VMA16)
SSDB
Motif
Pfam: ATP-synt_C DUF3671
Other DBs
NCBI-GeneID: 856421
NCBI-ProteinID: NP_011891
SGD: S000001068
UniProt: P23968
Structure
PDB: 

Position
VIII:160844..161485
AA seq 213 aa
MNKESKDDDMSLGKFSFSHFLYYLVLIVVIVYGLYKLFTGHGSDINFGKFLLRTSPYMWA
NLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIV
FSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSAL
FVKILVIEIFGSILGLLGLIVGLLMAGKASEFQ
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaacaaggaatctaaagatgatgatatgtccttggggaagttttccttctcccacttc
ctatattacttggtgctaatagtagtaatagtgtacggtttgtacaagcttttcactgga
catggatccgacattaatttcgggaagttcttgttaaggacatccccttatatgtgggcc
aatcttggtattgccctttgtgtaggcttaagtgtcgtgggggcagcatggggtattttc
attactggttcatccatgattggtgccggtgtgcgtgctccaaggattaccaccaagaat
ttaatttccattattttctgtgaagtggttgccatttacggtctgattattgccattgtc
ttttcttcgaaattgactgtggctactgctgagaacatgtactcgaaatcaaacctgtac
actggttattctcttttctgggcaggtatcactgtcggtgcttccaatttgatttgtggt
atcgctgtcggtatcaccggtgcgactgctgccatttccgatgctgctgattccgcattg
tttgttaaaattttggtcattgaaattttcgggtccattttaggtttattaggtttgatt
gttggtttattgatggccggtaaagcttctgaatttcagtaa

DBGET integrated database retrieval system