KEGG   Saccharomyces cerevisiae (budding yeast): YHR030CHelp
Entry
YHR030C           CDS       T00005                                 

Gene name
SLT2, BYC2, LYT2, MPK1, SLK2
Definition
(RefSeq) mitogen-activated serine/threonine-protein kinase SLT2
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04138  Autophagy - yeast
sce04139  Mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YHR030C (SLT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YHR030C (SLT2)
   04139 Mitophagy - yeast
    YHR030C (SLT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YHR030C (SLT2)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     YHR030C (SLT2)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   YHR030C (SLT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Spt20 WD40 APH TFIIA
Motif
Other DBs
NCBI-GeneID: 856425
NCBI-ProteinID: NP_011895
SGD: S000001072
UniProt: Q00772
Position
VIII:complement(168890..170344)
Genome map
AA seq 484 aa AA seqDB search
MADKIERHTFKVFNQDFSVDKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVF
SKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQIIK
SGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSE
NPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGKPIFKGKDYVN
QLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQALDLLEQMLA
FDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQMVIQEVQDFRL
FVRQPLLEEQRQLQLQQQQQQQQQQQQQQQQPSDVDNGNAAASEENYPKQMATSNSVAPQ
QESFGIHSQNLPRHDADFPPRPQESMMEMRPATGNTADIPPQNDNGTLLDLEKELEFGLD
RKYF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctgataagatagagaggcatactttcaaggtcttcaatcaagatttcagtgtagat
aagaggtttcaacttatcaaagaaatagggcatggagcatacggcatagtgtgttcagcg
cggtttgcagaagctgccgaagataccacagttgccatcaagaaagtgacaaacgttttt
tcgaagaccttactatgtaaaagatccctacgtgagctaaagcttttgagacatttcaga
ggccacaaaaatattacatgtctttatgatatggatattgttttttatccagacgggtct
atcaatggactatatctttatgaggaacttatggaatgtgatatgcaccaaatcatcaaa
tccggtcaacctttgacggatgctcactatcaaagtttcacataccaaatattatgtggt
ttaaagtatattcattctgcagatgtcttgcatcgtgatttgaagcccggcaatttgctt
gtcaatgcagattgtcaattgaaaatctgtgattttgggttagctagaggttattcggag
aatcctgtcgaaaacagtcaatttttgacggagtacgtggccactagatggtatagagct
ccggaaataatgttgagttaccaaggatataccaaggcgattgacgtatggtcagctggc
tgtattttagcggagtttcttggtggaaagccaatcttcaaaggaaaggattacgttaat
caattgaatcaaatattacaagttttagggacacccccagacgaaactttaagaaggatt
ggttctaaaaatgttcaggactacatacatcaattaggtttcattccaaaagtacctttt
gtcaatttatacccaaatgccaattcacaagcattagacttattggagcaaatgctcgcg
tttgaccctcaaaagagaattaccgtggatgaggccctggagcatccttacttgtctata
tggcatgatccagctgacgaacctgtgtgtagtgaaaaattcgaatttagttttgaatcg
gttaatgatatggaggacttaaaacaaatggttatacaagaagtgcaagatttcaggctg
tttgtgagacaaccgctattagaagagcaaaggcaattacaattacagcagcagcaacag
cagcagcaacagcaacagcaacagcaacagcagccttcagatgtggataatggcaacgcc
gcagcgagtgaagaaaattatccaaaacagatggccacgtctaattctgttgcgccacaa
caagaatcatttggtattcactcccaaaatttgccaaggcatgatgcagatttcccacct
cgacctcaagagagtatgatggagatgagacctgccactggaaataccgcagatattccg
cctcagaatgataacggcacgcttctagaccttgaaaaagagctggagtttggattagat
agaaaatatttttag

DBGET integrated database retrieval system