KEGG   Saccharomyces cerevisiae (budding yeast): YHR036W
Entry
YHR036W           CDS       T00005                                 

Gene name
BRL1
Definition
(RefSeq) Brl1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Brr6_like_C_C
Other DBs
NCBI-GeneID: 856431
NCBI-ProteinID: NP_011901
SGD: S000001078
UniProt: P38770
Position
VIII:180345..181760
AA seq 471 aa
MESFENLSIRDSFTSGMEHVDEELGGLSDLSISKQGPTLSPQLINRFMPHFPSSPSPLRN
TLDFSAAKADEEEDDRMEIDEVDDTSFEEEYNNEPIETHTEATENAVVEEIEATPEERQK
QEKNESQDQSVEEVENIVSPHRSTVIKALLSPTDLGVAAATKVEGVVPLPPSANQDDNES
SNNNAEGEDIIRNEEVEDEIKSSLGNHKSSQYANAFDSEIIKRELRSRSKYQPIQVSFNT
HNYFYSDKDGIKTYSLTKPNHNKIDEFYDQNEAFKLPKPWSPNSHPASRASYALMSYLQL
FLNAITTVVIFSFILSFIIALQKDLKSTWEQRKHELQYESRICQEQYLTNRCNQTPGLPA
LGEQCAIWKQCMDRNNDIFFRARSTLSAKLFGDIINSFIDPLNWKTLFVIFCGVITWCFS
SNFLLGFVRAKSYYGNGIKTYPLPSSPKSPTSEETHSSMTASGEDSHLLKQ
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggaaagttttgaaaatttgagcataagagacagtttcactagcggaatggaacacgtt
gacgaggagttaggaggcctctccgacctaagtatatctaagcaggggccaactttgtca
ccacagcttatcaaccgatttatgccccattttccctcgagcccatcacctctgcgaaat
acattggattttagtgctgctaaagctgatgaggaagaagatgaccgaatggaaatagat
gaggttgatgatacaagttttgaagaagaatataataacgagccaatcgaaactcatact
gaagcgactgagaatgccgtggtggaagaaatcgaggctaccccagaagaaagacaaaag
caagagaagaatgaaagccaagaccaaagtgtagaagaggtcgagaacattgtttcaccg
catcgttcaactgtcataaaggcattattatcaccgaccgatttaggtgtggccgcagct
actaaagttgaaggtgttgtgccattaccaccatcggccaatcaagatgacaatgaaagt
tcgaataacaacgcagagggtgaagacataatcagaaatgaagaagtcgaagatgagatc
aaatcatcacttggcaaccacaagtcaagccagtacgcaaatgcgttcgattcggaaata
atcaagagggaattaagatcaagatcaaaatatcaaccaattcaggtttcattcaataca
cacaactacttctattcagataaggacggcattaaaacttattctcttactaaaccaaat
cacaataaaatagatgaattttacgaccaaaatgaagctttcaagttgcctaaaccatgg
tcacccaattcacatccggcatcaagagcgtcatatgccctaatgtcatatttacagtta
tttctcaatgcgatcactacagtagtgatttttagttttatactctcatttatcatagcg
cttcaaaaggacttgaaatccacatgggaacaaagaaaacatgaactgcagtacgaatcc
agaatttgtcaagagcagtacctcacaaatcgttgtaaccagacgcctggcttgccggct
ctgggcgaacaatgtgctatatggaaacagtgtatggacagaaataacgatatctttttc
cgtgcaagatcaacgttgagcgcaaaattgttcggagacattatcaactcattcatagat
ccattaaactggaaaacactatttgttattttttgtggtgtgataacttggtgtttcagt
tcgaatttcttactgggttttgtaagagccaagagctactatggcaatggcatcaaaaca
tatcccttgccatcttcaccgaaatcgccgacatcagaagaaacacactcatctatgaca
gcatctggagaggactcacacctacttaagcaatag

DBGET integrated database retrieval system