KEGG   Saccharomyces cerevisiae (budding yeast): YHR037WHelp
Entry
YHR037W           CDS       T00005                                 

Gene name
PUT2
Definition
(RefSeq) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00250  Alanine, aspartate and glutamate metabolism
sce00330  Arginine and proline metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YHR037W (PUT2)
   00330 Arginine and proline metabolism
    YHR037W (PUT2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     YHR037W (PUT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 856432
NCBI-ProteinID: NP_011902
SGD: S000001079
UniProt: P07275
Structure
PDB: 

Position
VIII:181977..183704
Genome map
AA seq 575 aa AA seqDB search
MLSARCLKSIYFKRSFSQLGHIKPPKHIRNEPVKPFRNIDLKDWDLLRASLMKFKSSSLE
VPLVINGERIYDNNERALFPQTNPANHQQVLANVTQATEKDVMNAVKAAKDAKKDWYNLP
FYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDL
YAQQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAA
LSNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQ
SGVVEGKYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLP
ESKSEEFLSDMFGILQSQNVVPMNTSASPISGGNLRGFMGPVIHEQSFDKLVKVIEDAKK
DPELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDI
IDNTSQYALTGAIFAKDRKAIEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTD
DKAGGPNILSRFVSIRNTKENFYELTDFKYPSNYE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgctatcagcaaggtgcctcaaatctatatacttcaagagatctttctcacaactggga
cacatcaagccccccaagcacataagaaatgaacctgttaagccatttagaaacatagac
ttaaaagactgggacttactgagggcttccttgatgaaattcaaaagttcttctttagaa
gtgccactggtcatcaatggggaaaggatatatgacaataatgaaagagcgcttttcccg
cagactaaccctgcgaaccatcaacaagtactggcaaacgtcacacaagccacggaaaaa
gatgtcatgaatgctgtaaaagccgccaaggatgccaaaaaggattggtacaatctaccg
ttttatgacagatctgcaatttttttgaaagccgctgacttaatttccaccaagtatcgt
tatgacatgttagctgctacaatgctgggccagggaaaaaatgtgtatcaggcagaaatc
gactgtatcacggaattatctgacttttttagatactatgtcaagtatgcatcagacttg
tatgctcaacaacccgtagagtcagcggatggtacttggaataaagctgaatacagacct
ttagagggatttgtgtatgctgtttcaccattcaactttactgctattgctgcaaacttg
attggggctccagctttgatgggtaatacagttgtctggaaaccttcacaaaccgctgcc
ctttcaaattacttattgatgactgttttggaagaagcgggattgccaaagggtgtcata
aatttcattccaggtgatccagttcaagttactgaccaggtattagctgataaagatttt
ggtgccttgcattttaccggttctacaaatgtctttaagagtttgtatggcaaaatacaa
agtggcgttgttgaagggaagtacagagattacccccgtattattggtgagacaggtggt
aaaaatttccatctagttcacccaagtgcaaatatatcacatgcagtactctctactatt
agaggcactttcgagttccaaggccaaaagtgctctgccgcttccaggttatatcttcca
gagtcaaaaagtgaagaattcttatccgatatgtttggcatattgcagtcacagaatgtt
gtcccaatgaacacatccgcaagtccaatttctggtgggaatttgcggggatttatgggt
cctgtcatccatgaacaaagtttcgacaaattagttaaagtaattgaagatgcaaagaaa
gaccccgagttggaaattctttacggtggacaatacgataaaagccaaggttggtttgtc
ggacccacagtcataaaagccaagagaccagatcatccatatatgtcaacagaatttttt
ggccctatattaactgtttacgagtatccagatactgaatttaatgaaatctgtgatatt
atcgataatacgagtcaatacgccttaactggtgctatttttgccaaagatcgtaaagca
attgaatacgcagatgagaagttgaagtttagcgcaggaaatttctacataaatgataag
tgtactggtgccgttgtttctcagcaatggtttggtggcgcaagaatgagtggtaccgac
gataaggctggtggtccaaacattttaagcagatttgtcagtattagaaacacaaaggag
aacttctacgagttgactgatttcaaatatccatcgaattatgaataa

DBGET integrated database retrieval system