KEGG   Saccharomyces cerevisiae (budding yeast): YHR038WHelp
Entry
YHR038W           CDS       T00005                                 

Gene name
RRF1, FIL1, KIM4
Definition
(RefSeq) Rrf1p
  KO
K02838  ribosome recycling factor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sce03012]
    YHR038W (RRF1)
Translation factors [BR:sce03012]
 Eukaryotic Type
  Release factors
   YHR038W (RRF1)
 Prokaryotic Type
   YHR038W (RRF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRF DUF2884 Cor1 Pox_polyA_pol_N
Motif
Other DBs
NCBI-GeneID: 856433
NCBI-ProteinID: NP_011903
SGD: S000001080
UniProt: P38771
Position
VIII:184066..184758
Genome map
AA seq 230 aa AA seqDB search
MILTTARLNCRPVTVPRLFNRSFSQSFIILKKKSSTPTEKVEEDEIDVNELLKKAETQFK
KTLEIQKQKMNEIKQGNFNPKVFNSLVFKNNRKFTDIATTSLKGKNALLITVFDPKDVKT
VISGVLAANLNLTPERVPNNDLQLKVSLPPPTTESRLKVAKDLKRVFEEYKQSSLKDSLG
TIRGSILKEFKSFKKDDAVRKAERDLEKLHKDYVNKLHDQFQKVEKSIVK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgattttaaccacagctagattaaattgtagaccagtcaccgttcctcgtctatttaat
cgttcttttagtcaatctttcataattttgaagaaaaaaagttctacccctactgagaaa
gtcgaagaagatgaaattgacgtgaatgaactgctgaaaaaggcagaaactcaattcaaa
aaaactttagaaattcaaaaacagaaaatgaatgagataaaacagggaaattttaatcct
aaggtattcaatagtttagtgttcaaaaataacagaaagtttacagatattgctaccaca
tccttgaaaggtaaaaatgcacttttaataacagttttcgaccccaaagatgtgaaaact
gtgatcagtggggtgcttgctgcgaacctgaatttaactcctgaaagggtcccaaataac
gatttgcaattgaaagtttcgttaccaccaccaactacagaatcccggttaaaagtagct
aaagacttaaagagagtatttgaagaatataagcagtcatcgctaaaagactcattagga
actatcagaggcagtattctaaaggaattcaaaagtttcaaaaaggatgatgccgttcga
aaagctgagagggatttggaaaaactgcataaggattacgtgaacaagcttcatgaccaa
ttccagaaagttgaaaaaagcattgtaaaatga

DBGET integrated database retrieval system