KEGG   Saccharomyces cerevisiae (budding yeast): YHR039CHelp
Entry
YHR039C           CDS       T00005                                 

Gene name
MSC7
Definition
(RefSeq) meiotic recombination directing protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF3953
Motif
Other DBs
NCBI-GeneID: 856434
NCBI-ProteinID: NP_011904
SGD: S000001081
UniProt: P38694
Position
VIII:complement(184875..186809)
Genome map
AA seq 644 aa AA seqDB search
MSKVYLNSDMINHLNSTVQAYFNLWLEKQNAIMRSQPQIIQDNQKLIGITTLVASIFTLY
VLVKIISTPAKCSSSYKPVKFSLPAPEAAQNNWKGKRSVSTNIWNPEEPNFIQCHCPATG
QYLGSFPSKTEADIDEMVSKAGKAQSTWGNSDFSRRLRVLASLHDYILNNQDLIARVACR
DSGKTMLDASMGEILVTLEKIQWTIKHGQRALQPSRRPGPTNFFMKWYKGAEIRYEPLGV
ISSIVSWNYPFHNLLGPIIAALFTGNAIVVKCSEQVVWSSEFFVELIRKCLEACDEDPDL
VQLCYCLPPTENDDSANYFTSHPGFKHITFIGSQPVAHYILKCAAKSLTPVVVELGGKDA
FIVLDSAKNLDALSSIIMRGTFQSSGQNCIGIERVIVSKENYDDLVKILNDRMTANPLRQ
GSDIDHLENVDMGAMISDNRFDELEALVKDAVAKGARLLQGGSRFKHPKYPQGHYFQPTL
LVDVTPEMKIAQNEVFGPILVMMKAKNTDHCVQLANSAPFGLGGSVFGADIKECNYVANS
LQTGNVAINDFATFYVCQLPFGGINGSGYGKFGGEEGLLGLCNAKSVCFDTLPFVSTQIP
KPLDYPIRNNAKAWNFVKSFIVGAYTNSTWQRIKSLFSLAKEAS
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggtctatctgaattcagacatgattaaccatttgaactccacagttcaagct
tactttaacttatggttggagaagcaaaacgcaataatgcgttctcaaccccaaattatt
caagataaccaaaaactgataggcattacaacgctagttgcctcaattttcactctgtat
gttttggtcaagataatctccaccccagcaaagtgttcctcgtcctataagccagtcaaa
ttctcccttcctgcaccagaggccgctcaaaataattggaagggcaagaggtctgtttcc
actaacatatggaatcctgaagaaccaaactttattcaatgtcattgtcccgccacaggt
caatatctaggttcttttccatcgaaaacggaagctgacatagatgaaatggtttctaag
gcaggcaaagctcaatctacttggggcaattctgatttctcaagaagattgagagttttg
gcttctttgcatgattatattctaaataatcaagatcttattgcgagagtagcgtgcagg
gattcaggaaagacaatgttagacgcatcgatgggtgaaatcttggttactttagaaaaa
attcaatggactataaagcacggccaaagagcgttgcaaccttcgagacgtccgggcccc
actaattttttcatgaagtggtataaaggtgcagaaatccgttatgaaccactgggtgtg
atcagttctatcgtttcctggaactatccattccataacttattgggtccaattattgca
gcattgttcacagggaatgccattgtagtaaaatgttcagaacaagttgtctggtcttcg
gaatttttcgtcgagctgatccgcaaatgtttggaagcttgtgatgaagatccagatttg
gttcagttgtgctattgtttacctccaactgaaaatgatgattccgcaaattatttcacc
tctcatcctggtttcaaacatatcacttttattggcagtcagcccgtagcgcactatatt
ctaaaatgcgctgccaaatcattgacacccgtagttgtggagcttggtggtaaggatgcg
tttattgtcctagactcagctaagaatttagatgctttatcttctatcatcatgaggggt
actttccaatcatccggtcaaaattgtattggtattgagagggttattgtcagtaaggaa
aattatgatgatttagtcaagattttgaatgaccgtatgactgcaaatccactacgccaa
gggtctgatattgatcatttagaaaatgttgatatgggggcaatgatatctgacaacaga
ttcgatgaactagaagctttggttaaagatgctgttgcaaagggagctcgtttacttcaa
ggtggttcccgcttcaaacatccaaagtatccacaaggtcattatttccaaccaactctt
ttggtggatgtcactccagaaatgaaaatagcacaaaacgaagtgtttggcccaatttta
gtcatgatgaaagctaagaatactgaccattgtgtacaactagccaactctgcgccattt
ggtctaggtggttctgtgtttggtgcggatatcaaggaatgcaattacgtcgcaaatagc
ctacaaactggtaatgtagccattaatgattttgctacattctatgtttgtcaattacca
tttggtggtatcaatggttcaggttacggtaaatttggtggtgaagaaggtcttttgggt
ttgtgcaatgccaaaagtgtctgttttgatactttgccttttgtctccactcaaattcca
aaaccattagactaccctattcgtaacaatgctaaggcttggaattttgtaaagagtttc
atcgtaggagcttatacaaattccacatggcaaagaataaagtcactgttctctttagct
aaagaagccagctag

DBGET integrated database retrieval system