KEGG   Saccharomyces cerevisiae (budding yeast): YHR041CHelp
Entry
YHR041C           CDS       T00005                                 

Gene name
SRB2, HRS2, MED20
Definition
(RefSeq) Srb2p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Med20
Motif
Other DBs
NCBI-GeneID: 856437
NCBI-ProteinID: NP_011907
SGD: S000001083
UniProt: P34162
Structure
PDB: 

Position
VIII:complement(join(189131..189749,189851..189864))
Genome map
AA seq 210 aa AA seqDB search
MGKSAVIFVERATPATLTELKDALSNSILSVRDPWSIDFRTYRCSIKNLPADVSKLMYSI
TFHHHGRQTVLIKDNSAMVTTAAAADIPPALVFNGSSTGVPESIDTILSSKLSNIWMQRQ
LIKGDAGETLILDGLTVRLVNLFSSTGFKGLLIELQADEAGEFETKIAGIEGHLAEIRAK
EYKTSSDSLGPDTSNEICDLAYQYVRALEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatcagccgttatattcgtggaaagagccactcccgctacactaacggaactg
aaggatgctctctcgaatagtatcctgtccgtgcgagacccttggtcgatagactttcgg
acgtaccggtgctctatcaagaacctacccgcggatgtctccaagctcatgtactcgata
acgttccaccaccatggccggcagaccgtgctaatcaaggacaactcagcgatggtgacg
actgccgcagcggcggatatccctccggcgctggtgttcaatggctcatctacgggcgtt
cctgagtccatagacactattttgtcgtccaagctgtccaacatctggatgcagaggcag
ctcatcaagggtgatgccggtgagacgttgatcttggacgggctcaccgtgcgactcgtc
aacctcttctcctccactgggttcaagggtctcctgatagaactgcaggcggacgaagcg
ggcgagtttgagaccaagattgcaggcatcgaaggacacctagctgaaatccgggccaag
gagtacaaaacctcatccgactcgttggggccggacaccagcaacgaaatatgtgatttg
gcgtaccagtatgttcgtgctctggagctgtga

DBGET integrated database retrieval system