KEGG   Saccharomyces cerevisiae (budding yeast): YHR045WHelp
Entry
YHR045W           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 856441
NCBI-ProteinID: NP_011911
SGD: S000001087
UniProt: P38775
Position
VIII:195551..197233
Genome map
AA seq 560 aa AA seqDB search
MNWSFLLQLVITILLIVLGANWLLSSFLLDFKRDLTGVALSQQSSISSVRKENETAYYRS
ILVPTGFPLTTGLGLSLKYKIRNGNFGDVWNAIMEVSKGKNIIKFTGREKSYSLSELNGM
AKRIFPKLSNKNFKNIGIANSIATVEGFTLSLASMMTSIRTGSIPHFLPAVPRQRLEDVD
VLIIDSWKSFKMLNGSEDWYKLIVVCDDPIESLQFDANCDVITWKELIDGFTKDTEYQYT
PPDDNSDDKKLFAYVTSPWNGTNSFNQICLVSNIAEFIKGFPLGNELNSNEYLTISTKLA
NSSASLQIWGKLFAVLLHGGSASFINPTTIDCESLQETTLLFTETKDVVKLIDSNSRSGL
LNKIYLSWATNLLSEGIFTKIARIEPHSLEKLRCVYLADNVKDAEVISTFPEKIPQLKKT
NRRITPSTEQLNKIRAQLGSRVVLELYCPYAIMGPVAHTNFYDYRVFGKSVDDNVVCYGT
LSTTLEGKMVETETNPHLNIEKKQGMLCIRGFSIGKPVESDRLEKALHLAERFGGGEGWM
PLVGVFGLFGQDGCLYIYNQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaattggtcttttctactacagctggtaataacaatattgttaattgtgctgggcgcc
aactggttgctaagctcttttctacttgattttaagagagatttaacaggggtggctttg
tcacagcaatctagcatatccagtgttcgtaaagaaaatgaaacagcatattatcgaagc
attttagtgcccacaggattcccattgacgacaggattagggctatctttaaaatacaaa
ataagaaatggcaatttcggtgatgtttggaatgccataatggaagtttccaagggaaaa
aacataattaaatttacaggaagagaaaaaagttattcgttgagtgaacttaatggtatg
gccaagcgcatatttccgaaactttccaataagaatttcaaaaatatcggtatagctaat
tctattgctaccgtagagggttttactctctccttggcttccatgatgacctctataaga
acaggttcaatacctcatttcttgccagctgttcctagacaacgactagaagatgttgat
gtcctgatcatcgactcatggaagtcttttaagatgctaaacggcagcgaggattggtac
aagcttattgttgtttgcgatgatcctatcgaatcactacaatttgatgcgaactgtgat
gttatcacttggaaagaacttatcgacggttttaccaaggatacagagtaccaatacacc
ccgccagatgacaactctgatgataagaaactttttgcatacgtaacttcaccatggaat
ggaactaatagttttaatcaaatctgtctggtgagtaatatagcggaattcatcaaaggg
ttccccttgggaaatgaattgaatagtaatgaatacctaaccatttcgacaaaattggca
aattctagtgcaagcctacaaatttggggaaagctttttgcagttttgctgcatggtggg
tctgcatctttcatcaatcctacaacgatagattgcgagtcgttgcaagaaactacgtta
ctgtttaccgaaacaaaggatgttgtcaaattaattgattctaattctagaagtgggctg
ctgaataaaatctacttatcctgggccacgaacttactgagcgagggtatttttacgaaa
attgccagaatcgagccacattctcttgaaaaattaagatgtgtttatttggcagataat
gtgaaagatgctgaggttatttcgacatttcctgaaaaaattcctcagctaaaaaagact
aaccgaagaatcaccccaagcactgaacaattgaataaaataagagctcaattaggatcc
cgtgtagtcctcgagttatattgtccctacgctatcatgggacctgtggcacataccaat
ttttatgactatagggtttttggaaaatctgtggacgataacgttgtatgttatggaaca
ctaagtacaacattagaaggaaaaatggtagaaacggaaacaaaccctcatttgaacata
gagaagaagcagggtatgttatgtattcgtggttttagcataggtaaaccagtagagtcc
gatcgtttagagaaagctttgcatttagctgaaaggtttggaggaggtgaaggatggatg
cctctagttggcgtttttggactatttggccaagacggttgcttatacatctataatcaa
tga

DBGET integrated database retrieval system