KEGG   Saccharomyces cerevisiae (budding yeast): YHR046CHelp
Entry
YHR046C           CDS       T00005                                 

Gene name
INM1
Definition
(RefSeq) inositol monophosphate 1-phosphatase INM1
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00562  Inositol phosphate metabolism
sce01100  Metabolic pathways
sce01130  Biosynthesis of antibiotics
sce04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    YHR046C (INM1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    YHR046C (INM1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     YHR046C (INM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 856442
NCBI-ProteinID: NP_011912
SGD: S000001088
UniProt: P38710
Position
VIII:complement(197398..198285)
Genome map
AA seq 295 aa AA seqDB search
MTIDLASIEKFLCELATEKVGPIIKSKSGTQKDYDLKTGSRSVDIVTAIDKQVEKLIWES
VKTQYPTFKFIGEESYVKGETVITDDPTFIIDPIDGTTNFVHDFPFSCTSLGLTVNKEPV
VGVIYNPHINLLVSASKGNGMRVNNKDYDYKSKLESMGSLILNKSVVALQPGSAREGKNF
QTKMATYEKLLSCDYGFVHGFRNLGSSAMTMAYIAMGYLDSYWDGGCYSWDVCAGWCILK
EVGGRVVGANPGEWSIDVDNRTYLAVRGTINNESDEQTKYITDFWNCVDGHLKYD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgatctagcttctatcgagaaattcctctgtgaactggctactgaaaaagta
ggaccaatcatcaaatccaagtccggcactcaaaaggattatgacttgaagactggctcc
aggagcgttgatattgtaactgctatcgataaacaggtcgaaaagttaatttgggaatcg
gtaaaaacccaatatccaactttcaagtttattggagaggaaagttatgtgaaaggggag
accgtgattactgatgatcctacctttattattgatccaattgatgggactacaaacttt
gttcatgatttcccatttagctgtacctctcttgggctcacagtaaacaaagagcccgta
gtaggcgttatatataatcctcacattaatcttctggtatccgcttctaaaggaaatggg
atgagagttaacaacaaggactatgactataaatcaaaattggaatctatgggttctcta
atactaaataaatccgtagtggcattacagccaggttccgctagagagggaaagaatttt
cagacaaaaatggccacatatgaaaaattactatcatgtgattacggttttgttcatgga
ttcagaaatttaggatcatctgcaatgacaatggcatatattgctatggggtaccttgat
agttattgggatggtggttgctattcgtgggacgtgtgtgctggatggtgtattttgaaa
gaagtgggcggtcgtgtagtaggtgccaatccaggtgaatggagtattgatgtcgacaat
aggacatatttggctgtgaggggaacaattaataacgaaagtgacgaacaaacaaaatat
atcacagacttttggaactgtgttgatggccatttgaaatatgactga

DBGET integrated database retrieval system