KEGG   Saccharomyces cerevisiae (budding yeast): YHR047CHelp
Entry
YHR047C           CDS       T00005                                 

Gene name
AAP1, AAP1'
Definition
(RefSeq) arginine/alanine aminopeptidase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Methyltransf_7 DUF1929
Motif
Other DBs
NCBI-GeneID: 856443
NCBI-ProteinID: NP_011913
SGD: S000001089
UniProt: P37898
Position
VIII:complement(198740..201310)
Genome map
AA seq 856 aa AA seqDB search
MSREVLPNNVTPLHYDITLEPNFRAFTFEGSLKIDLQINDHSINSVQINYLEIDFHSARI
EGVNAIEVNKNENQQKATLVFPNGTFENLGPSAKLEIIFSGILNDQMAGFYRAKYTDKVT
GETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKK
YTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLAARTLRFF
EDTFNIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQH
ELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRALNLDS
LRSSHPIEVPVNNADEINQIFDAISYSKGSSLLRMISKWLGEETFIKGVSQYLNKFKYGN
AKTGDLWDALADASGKDVCSVMNIWTKRVGFPVLSVKEHKNKITLTQHRYLSTGDVKEEE
DTTIYPILLALKDSTGIDNTLVLNEKSATFELKNEEFFKINGDQSGIFITSYSDERWAKL
SKQANLLSVEDRVGLVADAKALSASGYTSTTNFLNLISNWKNEDSFVVWEQIINSLSALK
STWVFEPEDILNALDKFTLDLVLNKLSELGWNIGEDDSFAIQRLKVTLFSAACTSGNEKM
QSIAVEMFEEYANGNKQAIPALFKAVVFNTVARLGGENNYEKIFNIYQNPVSSEEKIIAL
RALGRFEDKELLERTLSYLLDGTVLNQDFYIPMQGIRVHKKGIERLWAWMQEHWDEIAKR
LQPGSPVLGGVLTLGLTNFTSFEALEKISAFYSRKVTKGFDQTLAQALDTIRSKAQWVSR
DREIVATYLREHEYDQ
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtgaagtactgccaaacaacgttaccccattgcattatgacattacactagaa
cctaatttccgtgcttttacgtttgaagggtcattaaaaattgacctgcagattaatgat
cattcgataaactctgtgcaaataaattacttagaaatagatttccattctgcacgtatt
gagggtgtcaatgccattgaagttaacaaaaacgaaaaccaacaaaaagctactcttgtc
tttcctaatggaacttttgaaaacctaggaccttctgcgaagttagaaattatcttttcc
ggtattctaaatgatcagatggcgggattttacagggctaagtatacggataaagtcaca
ggggagacgaagtacatggctactactcagatggaagccacagatgctagaagagccttt
ccttgttttgacgaaccaaatttgaaggcgacttttgcagtaactttggtctctgaatcg
tttctgactcatttgtccaacatggatgtcaggaatgaaacaatcaaagagggtaagaaa
tatacaacttttaacacgactccaaagatgtctacgtacttagtagcatttattgtagct
gacctgagatacgtggaaagcaataatttccgtattccagtaagagtttattctacccca
ggggacgaaaaatttggtcagtttgcagccaatttagctgctaggaccttgagattcttt
gaggacaccttcaacatagaatatccattgccaaagatggatatggtggcagttcatgag
ttttctgctggtgctatggaaaactgggggctagtgacttatagagttattgatttgtta
ttagacatagaaaattcgagtttagatcgcattcaaagagttgctgaggttattcagcat
gaactagcccaccaatggttcggcaacttggtcaccatggattggtgggaaggcttatgg
ttgaatgaaggttttgccacttggatgtcttggtactcttgcaacaagtttcaaccagaa
tggaaagtttgggagcaatatgttactgacaatttacaacgtgctctaaatttagattca
ttaagatcttcccatccaattgaagttcccgttaataatgcggacgaaatcaatcaaatt
tttgatgctatttcttattctaaaggatcttctttattgaggatgatttccaaatggttg
ggtgaagagacttttattaaaggtgtgtcccaatacctgaataaattcaaatacggtaat
gcaaagaccggagatttgtgggacgccttagcagatgcctctggcaaggacgtttgttcg
gtgatgaacatctggacaaaacgtgttggttttccagtgttatctgtcaaggaacacaag
aacaaaatcacattaactcaacaccgttatttaagtaccggtgatgttaaagaagaggaa
gatacaaccatataccccattttgttagctttgaaagacagtacaggtatcgataacaca
ttggtattgaacgaaaaatctgctactttcgaattaaagaatgaagagttcttcaagatt
aatggtgaccaatctggtattttcattacctcttattctgacgaaagatgggctaagcta
tccaaacaggcaaatttattatccgtagaggatcgtgttggcttagtcgcagatgcaaaa
gccctttctgcatctggctatacctctactactaacttcttgaatttaatttctaattgg
aaaaacgaggattcatttgttgtttgggaacaaatcattaatagtttatccgctctgaaa
tctacttgggtcttcgaaccagaggatatattgaatgctctagataaatttactttggat
ctagtacttaacaaactttctgaattggggtggaatattggcgaagacgactcctttgct
atccaacgtttaaaagtgacccttttcagtgccgcatgcacttctggcaatgaaaaaatg
caatcgattgcggtagaaatgtttgaggaatacgccaatgggaacaaacaggccatacct
gcactgttcaaggcagttgttttcaacaccgttgccagacttggcggagaaaacaattac
gaaaagattttcaacatctatcaaaaccctgtttcgtcagaagaaaagattatcgctttg
agagctttgggcagatttgaagacaaagaacttttagaaaggacattgtcttatctgcta
gatggtacagttttgaatcaagatttttacatcccaatgcaaggcattagagttcataag
aagggtattgaaaggttatgggcttggatgcaagaacactgggacgaaattgctaagaga
ttacagccaggctcgcctgtgttgggtggcgtgttgacattgggtttaactaattttacc
tcttttgaagcccttgaaaaaattagtgcgttctatagtagaaaggtcactaaaggtttt
gatcaaaccctggctcaagccttagacactattagatccaaggcgcaatgggtgagcaga
gatcgtgaaatcgttgctacctacttgcgtgagcatgagtatgatcaatag

DBGET integrated database retrieval system