KEGG   Saccharomyces cerevisiae (budding yeast): YHR048W
Entry
YHR048W           CDS       T00005                                 

Gene name
YHK8
Definition
(RefSeq) Yhk8p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 856444
NCBI-ProteinID: NP_011914
SGD: S000001090
UniProt: P38776
Position
VIII:204607..206151
AA seq 514 aa
MVAEFQIASAQSSALTSTEEEHCSINSDKAAKLDLELTSERKNDGKQSHEVTFNEDIADP
EDIARHMSTARRYYISSLITFTSMVITMISSSWTLPSTHIIEHFHISHEVSTLGITLYVF
GLGIGPLFLSPLSELYGRRITFLYALTLSIIWQCLTIWSKTITGVMFGRFLSGFFGSAFL
SVAGGAIADIFDKDQIGIPMAIYTTSAFLGPSLGPIIGGALYHQSYKWTFITLLITSGCC
LVMIIFTIPETYKPMLLIRKAKRLRKEKNDQRYYAVLEVTREQTSLLSAIFLSTKRPFGL
LLRDRMMGVLCFYTGLELAIIYLYFVAFPYVFKKLYNFGPMEIACSYIGIMVGMILSAPT
CLLFQKTFEWRVKRNNGVKTPEMRFEPLFYGAFLTPVGLFIFAFTCYKHVHWIAPIIGSA
IFGSGVYFVFTGVFAYTVDAYRRYAASGMACNTFVRCIMAGVFPLFGLQMYKSMGVNWAG
FLLAMVTVAMIPVPFLFTKYGARLRAKSPYAWDD
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggttgcagaatttcaaatagcgagtgcacagtcatcggcattgacatctactgaagaa
gagcattgttcaataaactcagacaaagccgcaaaactggatctggaattgaccagtgaa
cgaaaaaatgacggcaaacaatcgcatgaagtgaccttcaacgaggacatcgcggaccca
gaagatatagcacggcatatgagcaccgcccgccggtattatatttcctcgttaattaca
ttcacatcgatggtaattacgatgatctcgtccagctggacgcttccttcaacgcacata
atcgaacactttcatatttcgcacgaagtcagcactctgggaattacgctttatgtgttt
gggctcggtataggacctttatttctgtctccactaagtgaactatatggacgaaggatc
acatttttatacgcccttacgctcagtatcatatggcagtgtttgaccatttggtccaag
accattacgggtgtcatgtttggcagatttctatccgggttttttggttcagcctttcta
agtgtggctggcggcgccattgccgatatattcgacaaagaccaaattggtattcctatg
gcaatatacactacatcggcctttttggggccctctttaggaccaatcattggtggagcc
ttataccatcaaagttataaatggacatttatcacacttctcatcacttctggatgttgt
ctcgttatgatcatctttaccatacctgaaacctacaaaccaatgctgttaatacgtaaa
gctaagagattgaggaaagagaaaaatgatcaacggtattatgctgtcctggaagtcacc
cgcgaacagacttccttactttccgcaatctttctctcaaccaaaagaccctttggcctg
ttacttcgagaccgaatgatgggtgtgctttgcttctatactggattggaacttgccata
atatatttatatttcgtagcgtttccttatgtgttcaagaaactttacaactttgggccc
atggagattgcatgctcctatatcggtattatggtcggcatgatactctcggctcctact
tgcttgttattccaaaaaacgtttgagtggagagtcaaaagaaataatggcgtcaagact
cccgaaatgagattcgagcctctgttctacggcgcctttttgaccccagttgggctcttc
atttttgcattcacctgctacaagcatgtccattggattgcaccaattataggcagtgca
attttcggttcaggtgtttatttcgtctttaccggtgtttttgcgtatacagtggatgcc
tatagaagatatgcagcttctggaatggcttgtaacacatttgtgagatgcataatggcc
ggtgtcttccctcttttcggactccagatgtacaagtcaatgggagtgaattgggccggc
tttctcttggcaatggtgaccgtagcgatgattcctgtcccatttctgtttaccaaatac
ggtgcccgactgagagccaagtcgccgtatgcatgggatgattga

DBGET integrated database retrieval system