KEGG   Saccharomyces cerevisiae (budding yeast): YHR049WHelp
Entry
YHR049W           CDS       T00005                                 

Gene name
FSH1
Definition
(RefSeq) putative serine hydrolase
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FSH1 BAAT_C
Motif
Other DBs
NCBI-GeneID: 856445
NCBI-ProteinID: NP_011915
SGD: S000001091
UniProt: P38777
Structure
PDB: 

Position
VIII:206462..207193
Genome map
AA seq 243 aa AA seqDB search
MTVQIPKLLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDE
KWQATLDADVNRAWFYHSEISHELDISEGLKSVVDHIKANGPYDGIVGFSQGAALSSIIT
NKISELVPDHPQFKVSVVISGYSFTEPDPEHPGELRITEKFRDSFAVKPDMKTKMIFIYG
ASDQAVPSVRSKYLYDIYLKAQNGNKEKVLAYEHPGGHMVPNKKDIIRPIVEQITSSLQE
ASE
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgactgtacaaattccaaaattattatttttacacggcttcttgcaaaacggtaaagtt
ttctccgaaaaatcatctggtattagaaaattattgaagaaggctaatgtccaatgtgac
tatattgatgcaccagtccttttagaaaagaaggacttgccatttgaaatggatgatgaa
aaatggcaagccaccctagatgcggatgttaacagagcctggttctatcacagcgaaatc
tctcacgaattggatatctcagaaggtttgaagtctgttgttgatcacatcaaggccaat
ggcccatacgacggcattgtcggtttctctcaaggtgccgcattgtcctctatcatcacc
aacaagatctcagagttagttccagaccatccacaattcaaggtaagtgtagtcatttcc
ggctattccttcaccgagccagacccagaacatcctggagaattgagaataaccgaaaaa
ttcagagactcatttgcggtaaaaccagacatgaagaccaagatgatcttcatctatggt
gcttctgaccaagccgtcccatccgtcagatccaagtacctgtacgatatttatttgaag
gcgcaaaatggtaataaggaaaaggtgttggcttacgaacaccctggtggacatatggtt
ccaaacaagaaggacattatcagaccaattgttgaacaaataacctcttccttacaagaa
gcttctgaataa

DBGET integrated database retrieval system