KEGG   Saccharomyces cerevisiae (budding yeast): YHR072W-AHelp
Entry
YHR072W-A         CDS       T00005                                 

Gene name
NOP10
Definition
(RefSeq) snoRNP complex protein NOP10
  KO
K11130  H/ACA ribonucleoprotein complex subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
Module
sce_M00425  H/ACA ribonucleoprotein complex
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    YHR072W-A (NOP10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YHR072W-A (NOP10)
   03032 DNA replication proteins [BR:sce03032]
    YHR072W-A (NOP10)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Sno RNPs
   Box H/ACA snoRNPs
    YHR072W-A (NOP10)
 Prokaryotic Type
    YHR072W-A (NOP10)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    Dyskerin complex
     YHR072W-A (NOP10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nop10p
Motif
Other DBs
NCBI-GeneID: 856471
NCBI-ProteinID: NP_058135
SGD: S000007455
UniProt: Q6Q547
Structure
PDB: 

Position
VIII:241664..241840
Genome map
AA seq 58 aa AA seqDB search
MHLMYTLGPDGKRIYTLKKVTESGEITKSAHPARFSPDDKYSRQRVTLKKRFGLVPGQ
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgcatttgatgtacactttgggcccagacggcaagagaatctatacattgaaaaaggtc
accgaaagtggtgaaatcacgaagtctgctcacccagctagattttctccagacgacaaa
tattcaagacaaagagtaactttgaagaagagatttggtttggtaccaggccaatag

DBGET integrated database retrieval system