KEGG   Saccharomyces cerevisiae (budding yeast): YHR132C
Entry
YHR132C           CDS       T00005                                 

Gene name
ECM14
Definition
(RefSeq) putative metallocarboxypeptidase
  KO
K08783  extracellular matrix protein 14 [EC:3.4.17.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YHR132C (ECM14)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.-  
     YHR132C (ECM14)
Peptidases and inhibitors [BR:sce01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   YHR132C (ECM14)
SSDB
Motif
Pfam: Peptidase_M14
Other DBs
NCBI-GeneID: 856533
NCBI-ProteinID: NP_012000
SGD: S000001174
UniProt: P38836
Position
VIII:complement(368502..369794)
AA seq 430 aa
MLHMNSLWGCFLFVLLAVTGAVQGLQEDYSEYAVYRFTSDNYSTLVRDVIAPLTDDYDVW
TRSNNFIDIKLPKEIGEQINDGQVIIDNMNELIQNTLPTSQMMAREQAVFENDYDFFFNE
YRDLDTIYMWLDLLERSFPSLVAVEHLGRTFEGRELKALHISGNKPESNPEKKTIVITGG
IHAREWISVSTVCWALYQLLNRYGSSKKETKYLDDLDFLVIPVFNPDGYAYTWSHDRLWR
KNRQRTHVPQCLGIDIDHSFGFQWEKAHTHACSEEYSGETPFEAWEASAWYKYINETKGD
YKIYGYIDMHSYSQEILYPYAYSCDALPRDLENLLELSYGLSKAIRSKSGRNYDVISACK
DRGSDIFPGLGAGSALDFMYHHRAHWAFQLKLRDTGNHGFLLPPENIKPVGKETYAALKY
FCDFLLDPEI
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgttgcacatgaattcgttgtggggttgttttcttttcgttttactagccgtgacaggt
gctgtgcagggtctccaagaggattacagtgaatacgctgtttacaggtttacttcagac
aactattctaccctggtaagagatgtgatcgcaccgctgacagatgattatgatgtatgg
acgagaagcaataatttcattgatattaagttgcctaaagaaataggtgagcagataaat
gatgggcaggtgatcatagataacatgaatgaattgatacaaaatacattgcctacaagt
cagatgatggcacgtgagcaggctgtttttgaaaatgattacgatttcttctttaacgaa
tacagggacctggatactatttatatgtggttggatcttctagaaagaagctttcccagt
ttggttgcagtggaacacttgggcaggacatttgaaggcagagagctaaaagctctgcat
atatccggaaacaagccagaatcaaacccggaaaagaagactattgttatcacaggtggt
atacatgccagagagtggatcagtgtcagtaccgtctgttgggcactttatcagttgtta
aatcgatatggttcgtctaagaaggaaaccaaatacctggacgatttggactttttagtc
atacctgtgttcaatccagacggatacgcatatacgtggtcgcatgacagactatggcgt
aagaatcgtcaaaggactcatgttcctcaatgtcttggtatcgacattgatcattccttt
ggtttccagtgggaaaaggcacacacccacgcttgcagcgaagagtatagtggggaaacg
cccttcgaagcttgggaagcatctgcttggtacaagtatattaatgaaaccaagggcgat
tacaaaatttatggctacattgacatgcattcgtattcacaggagattttatatccctac
gcatactcgtgtgatgccttgcccagagacttagaaaatttgttggagttatcatatggc
ttatccaaggccatccgttcaaaatcaggtagaaactacgacgtaatctccgcatgtaag
gaccgtggttccgacatattccccggcctcggtgcaggttctgcgttggacttcatgtac
caccacagagcacattgggcattccagttgaaattacgggatacagggaaccatggattt
ttattgcctccagaaaacatcaagccagttggaaaggaaacttatgctgctttaaagtac
ttttgtgacttcctactagacccagagatataa

DBGET integrated database retrieval system