KEGG   Saccharomyces cerevisiae (budding yeast): YHR144C
Entry
YHR144C           CDS       T00005                                 

Gene name
DCD1
Definition
(RefSeq) deoxycytidine monophosphate deaminase
  KO
K01493  dCMP deaminase [EC:3.5.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00240  Pyrimidine metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    YHR144C (DCD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sce02044]
    YHR144C (DCD1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.12  dCMP deaminase
     YHR144C (DCD1)
Secretion system [BR:sce02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   YHR144C (DCD1)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam SNAD4 APOBEC4_like Cupredoxin_1 Holin_BhlA
Other DBs
NCBI-GeneID: 856548
NCBI-ProteinID: NP_012014
SGD: S000001187
UniProt: P06773
Position
VIII:complement(387788..388726)
AA seq 312 aa
MLIGVSGTKFCGCEDVINMLVDHFHFELLNHLDNPEEILDYATKNYTKNSVIFLEKLSLL
EKLEKRPFFVHLSIDAPVTTRVALYRKTTQAESLSLEQIIQAIDQHDFQPEGIKLREKSH
LRFKIVNEDRRGRRQSLINNITTQLKILDDKEKQMAPLMRPSWDSYFMKLATLAASRSNC
MKRRVGCVIVRECRVIATGYNGTPRHLTNCFNGGCPRCNDGDSRNLHTCLCLHAEENALL
EAGRDRVGQNATLYCDTCPCLTCSVKIVQTGISEVVYSQSYRMDEESFKVLKNAGITVRQ
FSFTEEPRIVMI
NT seq 939 nt   +upstreamnt  +downstreamnt
atgttaattggtgtaagtggtacgaaattttgcggatgcgaagatgttattaacatgttg
gttgatcattttcattttgaattactcaatcacctagataatccagaggagatattagat
tatgctacgaaaaattacacaaaaaattcagttatattcctagaaaaattatcattactg
gagaaactggaaaagagaccattttttgttcatctttctatcgacgctcctgtcactaca
agggtagcattatacaggaaaacgactcaagcagaaagcttatcattagaacaaataata
caagccattgatcaacatgactttcagcctgaaggcatcaaattaagggagaaatcccat
ttgagatttaaaatagttaatgaggaccgcagaggaaggagacagagcttgattaataac
attaccacacaattaaagattctcgatgacaaagagaaacaaatggctccattaatgagg
cctagttgggatagctattttatgaagttagccacactagcagcatctcgttccaattgc
atgaaacgtagagttggttgcgtgattgtgagagaatgcagagtgattgctactggctat
aatgggactcctcgacatttaacaaattgtttcaatggcggttgcccacgttgcaatgac
ggtgattctagaaatctgcacacttgcttatgcttacatgcagaagagaatgcactactg
gaagctggcagggatcgtgtaggtcaaaatgcgaccttatactgtgatacttgcccttgc
ttaacatgttctgtaaagattgttcaaacaggcatcagtgaagtagtttatagccaaagt
tatagaatggacgaggaaagtttcaaggtcttgaagaatgcgggaataaccgtccggcaa
ttcagctttacggaagaaccaagaattgtgatgatttaa

DBGET integrated database retrieval system