KEGG   Saccharomyces cerevisiae (budding yeast): YHR161CHelp
Entry
YHR161C           CDS       T00005                                 

Definition
(RefSeq) Yap1801p
  KO
K20044  phosphatidylinositol-binding clathrin assembly protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YHR161C
Membrane trafficking [BR:sce04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    YHR161C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ANTH ENTH
Motif
Other DBs
NCBI-GeneID: 856566
NCBI-ProteinID: NP_012031
SGD: S000001204
UniProt: P38856
Position
VIII:complement(420373..422286)
Genome map
AA seq 637 aa AA seqDB search
MTTYFKLVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTAWTIVYKSL
LVVHLMIREGSKDVALRYYSRNLEFFDIENIRGSNGSASGDMRALDRYDNYLKVRCREFG
KIKKDYVRDGYRTLKLNSGNYGSSRNKQHSINIALDHVESLEVQIQALIKNKYTQYDLSN
ELIIFGFKLLIQDLLALYNALNEGIITLLESFFELSHHNAERTLDLYKTFVDLTEHVVRY
LKSGKTAGLKIPVIKHITTKLVRSLEEHLIEDDKTHNTFVPVDSSQGSAGAVVAKSTAQE
RLEQIREQKRILEAQLKNEQVAISPALTTVTAAQSYNPFGTDSSMHTNIPMAVANQTQQI
ANNPFVSQTQPQVMNTPTAHTEPANLNVPEYAAVQHTVNFNPVQDAGVSAQQTGYYSINN
HLTPTFTGAGFGGYSVSQDTTAASNQQVSHSQTGSNNPFALHNAATIATGNPAHENVLNN
PFSRPNFDEQNTNMPLQQQIISNPFQNQTYNQQQFQQQKMPLSSINSVMTTPTSMQGSMN
IPQRFDKMEFQAHYTQNHLQQQQQQQQQQQQQQQQQPQQGYYVPATAGANPVTNITGTVQ
PQNFPFYPQQQPQPEQSQTQQPVLGNQYANNLNLIDM
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatatttcaagttggtaaaaggtgctaccaagatcaagtcagccccgcccaaa
cagaagtatctggatccgatactgttggggaccagcaatgaagaggatttctatgagatc
gtgaagggtttggattcccgaattaatgacacggcgtggactattgtgtataaatcgctg
ttggtggttcatttgatgataagggagggttccaaagatgttgcattgcggtactactct
aggaacctggagttttttgacattgaaaacatacgtggctccaatggcagtgcgtctgga
gacatgagggcacttgatagatacgataattatctgaaggtgagatgcagggagtttggt
aaaatcaaaaaggactatgtgagagacggctatcgaacactgaagctgaacagtggcaat
tacggaagctccagaaacaagcaacactctatcaatatagcactagatcatgtggagtcc
ctagaggtacaaatacaagccctgattaaaaacaagtatacacaatatgatttgagtaac
gaattgatcatatttggtttcaagctgcttattcaagacctgctagcgctatataatgct
ctcaacgaaggtatcataactctgctggagtcttttttcgaactatctcatcataatgca
gagagaactctagacctgtacaagacgtttgttgatttgaccgagcacgttgtcaggtac
ttgaagagcgggaagactgcgggcttgaaaatacccgtcatcaagcatatcactaccaaa
ctggtcagatcgctagaagaacatctgatagaggatgataagacgcacaacacttttgtg
cccgttgacagttctcaaggaagtgctggggccgtagtagccaaatctactgcacaggaa
aggttggagcaaatccgggaacaaaaaaggatactagaggcacaattgaaaaacgaacaa
gtagcgatttcccctgctctaactactgtcacggcggctcaatcttacaacccgtttgga
acagactcttctatgcatactaacattccaatggctgtggctaatcaaacgcaacagatc
gcaaataacccatttgtatctcaaactcagccacaggtgatgaatacaccaaccgctcat
acagagcccgcaaatttaaacgttcctgaatatgcagcggtccaacacacagtgaacttc
aaccctgtacaagatgctggcgtaagtgcccaacaaacggggtactattcgattaacaac
catttaacacccacatttacaggtgcagggtttggaggatactccgtttcacaggataca
actgccgcttctaatcaacaagtctctcattcacaaactggttctaacaacccgttcgca
ttgcacaacgccgcgacgatcgcaacagggaatcctgcacacgaaaatgtcttaaataac
ccattttcacgaccaaactttgatgaacaaaataccaatatgccgctacaacaacagata
ataagtaacccttttcaaaaccaaacgtacaatcaacaacaatttcaacaacaaaaaatg
cctttgagctcgatcaatagcgttatgacaacccctactagcatgcagggatcgatgaat
attcctcagcgttttgataaaatggaatttcaggctcactacactcagaatcatctccaa
caacagcaacaacagcaacagcaacaacagcaacagcaacaacagcaaccacaacagggt
tattatgtgcctgcaactgcaggagccaaccctgttacaaatataactgggacagttcaa
cctcaaaatttccctttctatccacaacagcaaccacaaccggaacagtctcaaacacag
caaccagttttaggaaaccaatatgctaacaacctcaatttaattgatatgtaa

DBGET integrated database retrieval system