KEGG   Saccharomyces cerevisiae (budding yeast): YHR163WHelp
Entry
YHR163W           CDS       T00005                                 

Gene name
SOL3
Definition
(RefSeq) 6-phosphogluconolactonase SOL3
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00030  Pentose phosphate pathway
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Module
sce_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sce_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YHR163W (SOL3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     YHR163W (SOL3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-GeneID: 856568
NCBI-ProteinID: NP_012033
SGD: S000001206
UniProt: P38858
Position
VIII:423724..424473
Genome map
AA seq 249 aa AA seqDB search
MVTVGVFSERASLTHQLGEFIVKKQDEALQKKSDFKVSVSGGSLIDALYESLVADESLSS
RVQWSKWQIYFSDERIVPLTDADSNYGAFKRAVLDKLPSTSQPNVYPMDESLIGSDAESN
NKIAAEYERIVPQVLDLVLLGCGPDGHTCSLFPGETHRYLLNETTKRVAWCHDSPKPPSD
RITFTLPVLKDAKALCFVAEGSSKQNIMHEIFDLKNDQLPTALVNKLFGEKTSWFVNEEA
FGKVQTKTF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggtgacagtcggtgtgttttctgagagggctagtttgacccatcaattgggggaattc
atcgtcaagaaacaagatgaggcgctgcaaaagaagtcagactttaaagtttccgttagc
ggtggctctttgatcgatgctctgtatgaaagtttagtagcggacgaatcactatcttct
cgagtgcaatggtctaaatggcaaatctacttctctgatgaaagaattgtgccactgacg
gacgctgacagcaattatggtgccttcaagagagctgttctagataaattaccctcgact
agtcagccaaacgtttatcccatggacgagtccttgattggcagcgatgctgaatctaac
aacaaaattgctgcagagtacgagcgtatcgtacctcaagtgcttgatttggtactgttg
ggctgtggtcctgatggacacacttgttccttattccctggagaaacacataggtacttg
ctgaacgaaacaaccaaaagagttgcttggtgccacgattctcccaagcctccaagtgac
agaatcaccttcactctgcctgtgttgaaagacgccaaagccctgtgttttgtggctgag
ggcagttccaaacaaaatataatgcatgagatctttgacttgaaaaacgatcaattgcca
accgcattggttaacaaattatttggtgaaaaaacatcctggttcgttaatgaggaagct
tttggaaaagttcaaacgaaaactttttag

DBGET integrated database retrieval system