KEGG   Saccharomyces cerevisiae (budding yeast): YHR164CHelp
Entry
YHR164C           CDS       T00005                                 

Gene name
DNA2, WEB2
Definition
(RefSeq) bifunctional ATP-dependent DNA helicase/ssDNA endodeoxyribonuclease DNA2
  KO
K10742  DNA replication ATP-dependent helicase Dna2 [EC:3.6.4.12]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YHR164C (DNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YHR164C (DNA2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     YHR164C (DNA2)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    YHR164C (DNA2)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     YHR164C (DNA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dna2 AAA_12 AAA_11 AAA_30 AAA_19 Viral_helicase1 PDDEXK_1 PIF1 Helicase_RecD Cas_Cas4 SRP54 UvrD-helicase ResIII AAA_16 MeaB CbiA NTPase_1 AAA_18 AAA_24 AAA cobW AAA_7 MobB UvrD_C_2 PhoH AAA_5
Motif
Other DBs
NCBI-GeneID: 856569
NCBI-ProteinID: NP_012034
SGD: S000001207
UniProt: P38859
Position
VIII:complement(424610..429178)
Genome map
AA seq 1522 aa AA seqDB search
MPGTPQKNKRSASISVSPAKKTEEKEIIQNDSKAILSKQTKRKKKYAFAPINNLNGKNTK
VSNASVLKSIAVSQVRNTSRTKDINKAVSKSVKQLPNSQVKPKREMSNLSRHHDFTQDED
GPMEEVIWKYSPLQRDMSDKTTSAAEYSDDYEDVQNPSSTPIVPNRLKTVLSFTNIQVPN
ADVNQLIQENGNEQVRPKPAEISTRESLRNIDDILDDIEGDLTIKPTITKFSDLPSSPIK
APNVEKKAEVNAEEVDKMDSTGDSNDGDDSLIDILTQKYVEKRKSESQITIQGNTNQKSG
AQESCGKNDNTKSRGEIEDHENVDNQAKTGNAFYENEEDSNCQRIKKNEKIEYNSSDEFS
DDSLIELLNETQTQVEPNTIEQDLDKVEKMVSDDLRIATDSTLSAYALRAKSGAPRDGVV
RLVIVSLRSVELPKIGTQKILECIDGKGEQSSVVVRHPWVYLEFEVGDVIHIIEGKNIEN
KRLLSDDKNPKTQLANDNLLVLNPDVLFSATSVGSSVGCLRRSILQMQFQDPRGEPSLVM
TLGNIVHELLQDSIKYKLSHNKISMEIIIQKLDSLLETYSFSIIICNEEIQYVKELVMKE
HAENILYFVNKFVSKSNYGCYTSISGTRRTQPISISNVIDIEENIWSPIYGLKGFLDATV
EANVENNKKHIVPLEVKTGKSRSVSYEVQGLIYTLLLNDRYEIPIEFFLLYFTRDKNMTK
FPSVLHSIKHILMSRNRMSMNFKHQLQEVFGQAQSRFELPPLLRDSSCDSCFIKESCMVL
NKLLEDGTPEESGLVEGEFEILTNHLSQNLANYKEFFTKYNDLITKEESSITCVNKELFL
LDGSTRESRSGRCLSGLVVSEVVEHEKTEGAYIYCFSRRRNDNNSQSMLSSQIAANDFVI
ISDEEGHFCLCQGRVQFINPAKIGISVKRKLLNNRLLDKEKGVTTIQSVVESELEQSSLI
ATQNLVTYRIDKNDIQQSLSLARFNLLSLFLPAVSPGVDIVDERSKLCRKTKRSDGGNEI
LRSLLVDNRAPKFRDANDDPVIPYKLSKDTTLNLNQKEAIDKVMRAEDYALILGMPGTGK
TTVIAEIIKILVSEGKRVLLTSYTHSAVDNILIKLRNTNISIMRLGMKHKVHPDTQKYVP
NYASVKSYNDYLSKINSTSVVATTCLGINDILFTLNEKDFDYVILDEASQISMPVALGPL
RYGNRFIMVGDHYQLPPLVKNDAARLGGLEESLFKTFCEKHPESVAELTLQYRMCGDIVT
LSNFLIYDNKLKCGNNEVFAQSLELPMPEALSRYRNESANSKQWLEDILEPTRKVVFLNY
DNCPDIIEQSEKDNITNHGEAELTLQCVEGMLLSGVPCEDIGVMTLYRAQLRLLKKIFNK
NVYDGLEILTADQFQGRDKKCIIISMVRRNSQLNGGALLKELRRVNVAMTRAKSKLIIIG
SKSTIGSVPEIKSFVNLLEERNWVYTMCKDALYKYKFPDRSNAIDEARKGCGKRTGAKPI
TSKSKFVSDKPIIKEILQEYES
NT seq 4569 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaacgccacagaagaacaagaggtctgcgagtatatctgtttcacctgcgaag
aagacagaggaaaaagaaataatacaaaatgattcaaaggcgatattatctaagcaaact
aagaggaaaaaaaagtatgcttttgctcctataaataacttaaatgggaagaacaccaag
gtatccaatgcaagtgtcctaaagtcaatagccgtttcacaagtacgaaatacatcaaga
acaaaagatataaacaaagcagttagcaagagcgtaaagcaattaccaaattcacaagtt
aaaccgaaacgggaaatgtctaatttgagtaggcatcacgatttcactcaagacgaggac
ggccccatggaagaagtaatatggaaatattcacctttacaacgagatatgtccgacaaa
acaacaagcgctgccgaatactctgatgactacgaagatgtccaaaatccctcttctaca
cctatagtccctaatcgactgaaaactgttcttagtttcacaaatatccaagtacccaac
gctgacgtaaatcaactcattcaagaaaatggaaatgagcaagtgcgtcctaaaccagca
gaaatatctaccagggagtctctccgtaatatagatgatattctcgatgatatagagggc
gatttaactataaaaccgacgataacgaaattcagcgatttgccatcttcacccatcaag
gcacccaacgttgaaaaaaaagcagaggtgaatgcagaagaagtagataaaatggattca
acaggagatagcaacgatggcgatgactctttgatagatattttaactcaaaagtatgtt
gagaaacgcaagagtgagagtcagataacaattcaaggcaacaccaatcaaaaaagtgga
gcccaggaaagttgtgggaagaatgataacacaaaatcgagaggagaaattgaagatcat
gaaaatgtagacaatcaagccaaaacaggcaatgcattttatgagaatgaagaagacagt
aattgccaaagaattaaaaaaaatgaaaaaatagaatacaattcttcagacgaattttca
gacgattcactaattgaactattgaacgaaactcaaacacaagtggaacctaacactatt
gaacaagatttagacaaagtggagaaaatggtctctgacgatttgagaattgctactgat
tccactttatccgcatatgctctcagagctaagtctggtgctccaagagacggcgtagta
cgattagtaatagtaagcttacgtagtgttgaattgccaaaaattggaacgcaaaaaata
ctagagtgtatagacggcaaaggcgaacaaagttctgttgtcgttcgacatccttgggta
tatttggaatttgaggttggggatgtaatacatattatagaagggaaaaatattgaaaac
aaacggcttctttctgacgacaaaaaccctaaaactcaactggctaacgacaacctgttg
gtgctaaaccctgatgtattattttcggcaacatcagtcggaagttcagtaggttgttta
agacgttcaattctgcaaatgcaatttcaagatccccgcggagaaccaagccttgtcatg
actttaggcaatatcgtacacgagttattgcaagactcaatcaaatacaagctctcgcat
aataaaatttctatggaaatcataatacaaaagctggattctttgttagaaacttattct
ttttcaattatcatttgtaatgaagaaatccagtacgttaaagaattagttatgaaagaa
catgctgaaaacattttgtacttcgtcaataaatttgtttcgaaaagtaactatggttgc
tacacatcaatttccggaacaagaagaacacagccaatttctatatccaatgtgattgat
attgaagaaaacatttggtctccaatatatggtcttaaagggttcctagatgcaactgtt
gaagctaatgttgaaaacaataaaaaacacatcgttcctttagaagtgaaaactggaaaa
tccagaagcgtttcatacgaggttcaaggccttatttatacacttctgttaaatgatcgc
tatgagataccgatagagttttttcttctttattttacgagggataaaaatatgacaaag
ttcccttctgttctgcactccattaaacatattctcatgtcccgaaatagaatgagtatg
aattttaagcatcaactccaagaggttttcggacaggctcaatcaaggtttgaattacca
cccttactgcgcgattcatcttgtgattcatgtttcatcaaagaatcatgcatggtgttg
aataagctactagaggacgggacaccagaagaaagtggcctggtagaaggtgagtttgaa
attttgacaaaccatttgtcgcaaaatctcgccaactacaaagagttttttacaaaatat
aatgatctaataactaaggaggagtcaagtataacatgtgtaaataaagaacttttctta
ttggatggttccacaagagaatccagaagtggaaggtgcctttctggcttggttgtgtca
gaggtggttgaacatgaaaaaacagagggagcgtatatatattgcttctcaagacgtaga
aatgataataactcgcagtcgatgttatcatctcaaattgctgctaatgactttgttatt
attagtgatgaggagggtcatttttgcttgtgccaaggtcgtgtacaatttataaatccc
gctaaaattggtatctccgtaaaacgaaagttattaaacaataggcttctagataaggaa
aaaggagtcactaccatccaaagtgtggtcgaatcagagctagaacaatccagtctcata
gctacccaaaatttggtcacatatagaatcgacaaaaatgatatccaacagagtttgtct
ttagcgcgatttaatcttttaagcttgtttttaccagctgtttcacctggcgtggatatt
gttgacgaaaggagtaaattatgtcggaagacaaagagatctgatggaggtaatgaaata
ctgcgatcacttttagttgataatagagcacctaagtttagagatgcaaatgatgatccc
gtcattccgtataagctttcaaaggatacaacattgaacttgaatcaaaaagaagcaata
gacaaagtaatgagggccgaagattatgcattgatattgggaatgccagggactggtaag
actactgttatcgcagaaattattaaaattctcgtttccgaggggaaacgcgtgcttttg
acatcatacacacattcagcagtggataatattttaataaaattgaggaacaccaacatt
agcataatgagattgggaatgaaacataaggtccatcctgacacgcaaaaatatgtcccg
aattacgcgtcagtgaaaagttataacgattatttgtccaaaattaacagcacctctgtt
gttgctaccacctgcttaggaattaacgatatactatttacactaaatgaaaaggatttt
gattatgtgattttggacgaggcaagtcaaatttcaatgcctgtcgctttgggacctctg
cggtatggaaataggtttattatggtaggagatcattaccagctaccgccattagttaaa
aatgacgcagctcgattaggtgggttagaagagtcactgttcaagactttctgtgaaaag
catccggaaagcgttgcagaactgactttacagtaccgtatgtgcggcgatattgtaact
ttgtctaatttcctaatttatgataataaattaaaatgcgggaataacgaagtttttgct
caatctttagagttaccaatgcctgaggccttgtcgcgctataggaatgaatcggctaac
tctaagcagtggcttgaggatatactagagcctacaagaaaagtggtatttttaaattac
gataactgcccggatattatcgaacaaagcgaaaaggataacattacgaatcacggggag
gcagaattgactctacaatgtgtggaaggaatgttattgagcggcgtaccatgcgaagat
attggtgtaatgacgttatacagagcacagttaagattactgaagaagatattcaacaaa
aatgtgtatgacgggctagagatcttgactgctgatcagtttcaaggtcgtgacaaaaag
tgcattattatttccatggttagaagaaattctcaattaaatggaggagcgctgctgaaa
gagctaagaagagtcaatgttgccatgacaagggccaaatccaagctgatcattataggt
tcaaaaagtacaatcggctctgttcctgaaataaaatcgttcgtgaacctgttagaagag
cgtaattgggtctatacaatgtgcaaggatgcactctacaaatacaaatttcccgacaga
tcaaacgctattgatgaggcacgcaaaggttgtggaaaaagaacaggtgccaaacccatc
acatcaaagtctaaattcgtaagcgataaacctatcataaaggaaattctacaagagtat
gaaagttga

DBGET integrated database retrieval system