KEGG   Saccharomyces cerevisiae (budding yeast): YHR165CHelp
Entry
YHR165C           CDS       T00005                                 

Gene name
PRP8, DBF3, DNA39, RNA8, SLT21, USA2
Definition
(RefSeq) U4/U6-U5 snRNP complex subunit PRP8
  KO
K12856  pre-mRNA-processing factor 8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YHR165C (PRP8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YHR165C (PRP8)
Spliceosome [BR:sce03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    YHR165C (PRP8)
 Complex C
   U5 SnRNP specific factors
    YHR165C (PRP8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PROCN PRP8_domainIV U6-snRNA_bdg PRO8NT U5_2-snRNA_bdg RRM_4 PROCT TPD Methyltr_RsmF_N
Motif
Other DBs
NCBI-GeneID: 856570
NCBI-ProteinID: NP_012035
SGD: S000001208
UniProt: P33334
Structure
PDB: 

Position
VIII:complement(429707..436948)
Genome map
AA seq 2413 aa AA seqDB search
MSGLPPPPPGFEEDSDLALPPPPPPPPGYEIEELDNPMVPSSVNEDTFLPPPPPPPSNFE
INAEEIVDFTLPPPPPPPGLDELETKAEKKVELHGKRKLDIGKDTFVTRKSRKRAKKMTK
KAKRSNLYTPKAEMPPEHLRKIINTHSDMASKMYNTDKKAFLGALKYLPHAILKLLENMP
HPWEQAKEVKVLYHTSGAITFVNETPRVIEPVYTAQWSATWIAMRREKRDRTHFKRMRFP
PFDDDEPPLSYEQHIENIEPLDPINLPLDSQDDEYVKDWLYDSRPLEEDSKKVNGTSYKK
WSFDLPEMSNLYRLSTPLRDEVTDKNYYYLFDKKSFFNGKALNNAIPGGPKFEPLYPREE
EEDYNEFNSIDRVIFRVPIRSEYKVAFPHLYNSRPRSVRIPWYNNPVSCIIQNDEEYDTP
ALFFDPSLNPIPHFIDNNSSLNVSNTKENGDFTLPEDFAPLLAEEEELILPNTKDAMSLY
HSPFPFNRTKGKMVRAQDVALAKKWFLQHPDEEYPVKVKVSYQKLLKNYVLNELHPTLPT
NHNKTKLLKSLKNTKYFQQTTIDWVEAGLQLCRQGHNMLNLLIHRKGLTYLHLDYNFNLK
PTKTLTTKERKKSRLGNSFHLMRELLKMMKLIVDTHVQFRLGNVDAFQLADGIHYILNHI
GQLTGIYRYKYKVMHQIRACKDLKHIIYYKFNKNLGKGPGCGFWQPAWRVWLNFLRGTIP
LLERYIGNLITRQFEGRSNEIVKTTTKQRLDAYYDLELRNSVMDDILEMMPESIRQKKAR
TILQHLSEAWRCWKANIPWDVPGMPAPIKKIIERYIKSKADAWVSAAHYNRERIKRGAHV
EKTMVKKNLGRLTRLWIKNEQERQRQIQKNGPEITPEEATTIFSVMVEWLESRSFSPIPF
PPLTYKNDTKILVLALEDLKDVYASKVRLNASEREELALIEEAYDNPHDTLNRIKKYLLT
QRVFKPVDITMMENYQNISPVYSVDPLEKITDAYLDQYLWYEADQRKLFPNWIKPSDSEI
PPLLVYKWTQGINNLSEIWDVSRGQSAVLLETTLGEMAEKIDFTLLNRLLRLIVDPNIAD
YITAKNNVVINFKDMSHVNKYGLIRGLKFASFIFQYYGLVIDLLLLGQERATDLAGPANN
PNEFMQFKSKEVEKAHPIRLYTRYLDRIYMLFHFEEDEGEELTDEYLAENPDPNFENSIG
YNNRKCWPKDSRMRLIRQDVNLGRAVFWEIQSRVPTSLTSIKWENAFVSVYSKNNPNLLF
SMCGFEVRILPRQRMEEVVSNDEGVWDLVDERTKQRTAKAYLKVSEEEIKKFDSRIRGIL
MASGSTTFTKVAAKWNTSLISLFTYFREAIVATEPLLDILVKGETRIQNRVKLGLNSKMP
TRFPPAVFYTPKELGGLGMISASHILIPASDLSWSKQTDTGITHFRAGMTHEDEKLIPTI
FRYITTWENEFLDSQRVWAEYATKRQEAIQQNRRLAFEELEGSWDRGIPRISTLFQRDRH
TLAYDRGHRIRREFKQYSLERNSPFWWTNSHHDGKLWNLNAYRTDVIQALGGIETILEHT
LFKGTGFNSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVY
VGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESIVFDICQILDGELDVLQIES
VTKETVHPRKSYKMNSSAADITMESVHEWEVSKPSLLHETNDSFKGLITNKMWFDVQLRY
GDYDSHDISRYVRAKFLDYTTDNVSMYPSPTGVMIGIDLAYNMYDAYGNWFNGLKPLIQN
SMRTIMKANPALYVLRERIRKGLQIYQSSVQEPFLNSSNYAELFNNDIKLFVDDTNVYRV
TVHKTFEGNVATKAINGCIFTLNPKTGHLFLKIIHTSVWAGQKRLSQLAKWKTAEEVSAL
VRSLPKEEQPKQIIVTRKAMLDPLEVHMLDFPNIAIRPTELRLPFSAAMSIDKLSDVVMK
ATEPQMVLFNIYDDWLDRISSYTAFSRLTLLLRALKTNEESAKMILLSDPTITIKSYHLW
PSFTDEQWITIESQMRDLILTEYGRKYNVNISALTQTEIKDIILGQNIKAPSVKRQKMAE
LEAARSEKQNDEEAAGASTVMKTKTINAQGEEIVVVASADYESQTFSSKNEWRKSAIANT
LLYLRLKNIYVSADDFVEEQNVYVLPKNLLKKFIEISDVKIQVAAFIYGMSAKDHPKVKE
IKTVVLVPQLGHVGSVQISNIPDIGDLPDTEGLELLGWIHTQTEELKFMAASEVATHSKL
FADKKRDCIDISIFSTPGSVSLSAYNLTDEGYQWGEENKDIMNVLSEGFEPTFSTHAQLL
LSDRITGNFIIPSGNVWNYTFMGTAFNQEGDYNFKYGIPLEFYNEMHRPVHFLQFSELAG
DEELEAEQIDVFS
NT seq 7242 nt NT seq  +upstreamnt  +downstreamnt
atgagtggactaccgcccccacctcctggttttgaagaggacagcgacttagcacttcca
ccaccaccaccaccaccgcctggatacgaaatcgaagaactggataatccgatggtgcca
tcatcggtaaatgaggatacattccttccgcctccaccacctcctccaagcaacttcgaa
ataaacgctgaagaaattgtggacttcacattaccaccgccaccaccccctccaggtcta
gatgaattagagactaaagcagaaaagaaagtagaattacatggaaagagaaaattggac
ataggaaaagatactttcgtcactcgaaaatcaagaaagcgtgcaaaaaaaatgaccaaa
aaggcaaagagaagcaatttatatactcctaaagccgagatgccaccggaacatctgcga
aagattattaatactcacagtgacatggcctccaaaatgtacaatactgataaaaaggct
tttctaggcgctctaaagtatttaccgcacgcgattttaaaattgttagagaacatgcct
catccatgggagcaagccaaagaagttaaagttttatatcacacttcaggagccataaca
tttgtgaatgaaacaccaagagtaatagagcctgtatatactgcccaatggtcagctact
tggatagcaatgaggagagaaaaacgagatagaacacattttaaaagaatgagatttcca
cctttcgatgatgacgaaccacctctgtcatatgaacagcacatagaaaatatcgagcca
ctggatcctataaatcttcccttagactctcaagatgatgaatatgttaaagattggctc
tacgattcccggcccttggaggaggatagtaaaaaggtcaatggtacatcttataaaaag
tggagttttgatttacctgaaatgtcgaacttatataggttatcaacgccacttagagat
gaagtaactgacaaaaattactattatcttttcgataaaaaatctttttttaacggtaaa
gcccttaataacgcaatccctggaggtcctaaatttgaacctttatacccaagagaagag
gaggaagattataacgaattcaactctatagatagagtaatatttagggttcctattaga
agcgaatataaggtagcgtttcctcatctatataattcccggccccgttcagtgcgcata
ccatggtataataatccagtgtcgtgtattatccagaacgatgaggagtacgacacgcct
gcacttttttttgatccatcgctgaacccaatacctcactttattgataataattcatcc
ctcaacgtatcaaatacaaaggaaaacggtgatttcactttacctgaagattttgcacct
cttttggctgaagaagaagaacttattttgccaaatacaaaagatgcgatgtcgttatat
cattcaccttttccatttaatagaactaaaggaaaaatggtgagagcacaagatgttgcc
ctggctaaaaaatggtttttgcaacatcctgacgaggagtatcccgttaaagttaaggtc
tcttaccaaaagctcttgaagaactacgtgctaaatgaattgcaccctactttgccaaca
aaccacaacaaaactaagttattgaagagtttaaaaaataccaagtattttcaacaaact
acaattgattgggtagaggcaggactccagctatgtcgacaaggacacaatatgttaaat
ttattaatccacagaaagggcctaacttatttacatctcgactacaatttcaatttaaaa
ccaactaaaaccttaaccacaaaagaacgtaaaaagtcaagacttggaaactcatttcat
ttgatgcgtgaattgctaaaaatgatgaaactgattgtagatacacatgtgcagtttagg
ttaggaaatgtagatgccttccagttagcagatggtatacattatattttgaaccacata
ggacaattgaccggtatttatcgttataaatataaagtaatgcatcaaatccgcgcatgt
aaagatctgaaacatatcatatattataagtttaataaaaatttgggaaaaggacctggt
tgtggattttggcaacctgcgtggagagtgtggctaaatttcttaagaggcactatacca
ctactcgaaagatatattggaaaccttatcacacgtcaatttgaaggccgttctaatgaa
attgtcaaaactacaactaaacaaagacttgacgcctactacgatcttgagttacgaaac
tcggtcatggatgacattttagaaatgatgcctgagagtattcgacagaaaaaggcaaga
actatactgcaacatttaagtgaggcttggagatgttggaaggctaatattccatgggat
gttcctggtatgccagccccaatcaaaaaaataattgaacggtatataaaatccaaagct
gatgcctgggtatctgcagctcattacaatcgagaacgtataaagcgtggagctcacgtc
gaaaagactatggttaaaaaaaatctggggcgtttaacgagactttggatcaaaaatgag
caggaacgtcaaaggcaaatacagaaaaacggtcccgaaattactcccgaagaggctacg
accatattttctgttatggttgagtggcttgaatcaaggagcttttcaccaataccattt
ccacctttaacttacaaaaatgatactaagatattagttcttgccctcgaagacctaaaa
gatgtctacgcatcaaaagtacgtttaaatgcatctgaaagggaagaacttgcgttgata
gaggaggcttatgataatcctcacgatactttgaacagaatcaaaaagtacttgttgacc
cagcgagtttttaagcctgttgatataaccatgatggaaaactatcaaaacatttcccct
gtttattcagttgatcccttggaaaagattaccgatgcatatcttgatcagtatttatgg
tacgaagctgaccaacgaaagcttttcccaaactggattaaaccaagtgattcagagata
ccacctcttctggtatacaagtggactcagggtataaacaacctatctgaaatttgggat
gtatccagaggccaatctgcagttttgcttgagactactttgggtgaaatggccgaaaaa
attgactttactttacttaatagattacttcgcctgattgtagatcctaatattgctgac
tatatcactgcaaaaaataatgttgttatcaactttaaagatatgagtcacgtcaacaaa
tatggcttaatacgcgggttgaagttcgcttctttcatattccaatattacggactagtt
atagatcttttactattgggtcaggaaagggctacagatttggctggtccagctaacaat
ccaaatgaatttatgcaattcaagagcaaagaagtagaaaaggcacatccgatcagactt
tacaccagatatttagatcgtatatatatgctttttcactttgaagaagatgagggagag
gaattgactgatgaatacttggcagagaatccagatccaaactttgaaaacagcatcgga
tacaataatagaaaatgctggcccaaagattcgcgcatgaggctaatacgtcaggacgtt
aacctagggcgagcagtgttttgggaaattcaaagtagggtgccaacttcgttaacgtca
attaaatgggaaaatgcttttgtttccgtatacagtaaaaacaatccgaacttactcttc
tctatgtgtggttttgaagtcagaatattaccaagacaaagaatggaagaggtggtttct
aacgatgaaggtgtttgggatttagttgacgaaagaaccaagcaaagaactgcaaaagca
tatttaaaggtatctgaagaagaaatcaaaaaatttgacagcagaataagaggcatattg
atggcctccggttcaaccacttttactaaagtggccgctaaatggaacacttcactgata
tcccttttcacatactttagagaagccattgttgccacggagccgttattagatatcctg
gtgaaaggagaaacaagaattcaaaaccgtgtcaaacttggtttaaattcgaaaatgcca
acaagatttccacctgctgttttttatacaccaaaagaacttggtgggttgggtatgatt
agtgcttctcatattttaattcctgcatctgacttaagttggtcaaaacagaccgatact
ggaattacgcattttcgtgctggtatgacgcacgaggatgaaaaattaatcccaactatc
ttccgttacatcactacttgggaaaatgaatttttagactctcaaagggtgtgggccgag
tatgcaacgaaaaggcaggaagctattcagcagaataggaggttagcttttgaagaactt
gaaggatcgtgggatcgtggtatacctcgtattagcactttatttcaaagagatcgacat
actctagcgtatgacagaggtcacagaatccgtagggaatttaaacagtactctctagag
agaaacagccccttttggtggacaaactcccaccatgacggtaaattatggaatttaaat
gcctatagaactgatgtgattcaagccctaggaggtattgaaacaattttggaacacact
ttatttaaggggactggttttaattcatgggaaggtttgttttgggaaaaggcgtccggg
tttgaggattccatgcaatttaagaagctaactcatgctcaaagaactggtttaagccaa
attccaaatcgtagatttaccttatggtggtcaccaactattaacagagcaaatgtctat
gtcggtttcttggtgcaattggatctgactggtatcttcctccatggtaaaattcctacg
ttaaaaatatctttaattcaaatattccgtgctcatttgtggcaaaaaatacatgaaagt
atagtttttgatatttgtcaaattctcgatggtgagctagatgttttgcaaattgaatct
gtgactaaagaaacagtgcatccccgcaaatcgtacaagatgaattcatctgccgctgac
ataactatggaaagtgttcatgaatgggaagtttcaaaaccctccctattacatgaaaca
aatgactcatttaagggattgattaccaacaaaatgtggtttgatgtacaattgagatac
ggtgattatgattctcatgatatatctcgttatgtgagggcaaaattcctcgattataca
acagataatgtcagcatgtatccctccccaacaggtgttatgatcggtatcgatttggct
tataacatgtatgatgcctatggtaattggttcaacggattaaaacctttgatacaaaat
agtatgagaacaattatgaaagctaacccagcattatatgtccttcgtgaacgtattaga
aaaggtcttcaaatatatcaatctagtgtacaggaaccatttttaaactcctcaaactat
gccgagttattcaataacgacattaaactcttcgttgacgacactaatgtgtatagagtt
actgtccacaagacttttgaagggaacgttgctacaaaagcaattaatggttgcattttc
actttaaatccaaagactgggcatctgtttctgaaaattatccatacctctgtatgggcc
ggtcaaaaacgtttaagccaattggccaaatggaaaacagctgaggaagttagtgctctt
gtgagatctttgcccaaagaagagcagccaaaacaaattatcgtcacaagaaaggcaatg
cttgatcctttagaggttcacatgcttgactttcctaacatagcaatcaggccaacagag
ctgcgactaccattttcagctgcaatgtcaatagataaactttctgatgttgtgatgaaa
gctactgaacctcagatggttctgtttaacatttatgatgattggttagaccgtatttca
tcgtacactgcattttctagacttacactacttttaagagctttaaagacgaacgaggaa
agtgccaaaatgattctactcagtgaccccacgatcactatcaaatcgtaccatttatgg
ccttcattcactgatgaacaatggatcactatcgaatctcaaatgagagatttgattttg
actgagtacggcagaaaatacaatgtcaatatatctgccttaactcaaacggaaattaaa
gatattatattgggtcaaaatatcaaggcaccatctgtgaagagacaaaaaatggctgaa
ttagaagctgccaggtcagaaaagcagaacgacgaagaagctgcaggtgcatcaactgtt
atgaaaactaaaactatcaatgcgcaaggtgaggagatagttgtagtagcttccgctgat
tacgaaagtcaaacgtttagttcaaagaatgaatggagaaaatctgcaattgctaataca
ctattatatttgaggttaaaaaacatttatgtttcggctgatgatttcgtggaggaacag
aatgtttacgtccttccaaaaaatttattaaagaagtttattgagatatccgatgtgaaa
atccaggtggcggcctttatttatggtatgtcagcaaaagatcatccgaaggtgaaagaa
atcaagactgttgtgctggtacctcaattaggccacgtaggatccgttcagataagcaac
atccctgacatcggagaccttccggatactgaaggccttgaactactcggttggatccat
acccagacagaagaacttaaattcatggctgcgtctgaagtagcaactcattctaaactt
tttgcggataagaaaagagactgcattgatatttcaattttttccaccccgggatcagta
tcattaagcgcttataacctgaccgacgaaggttaccaatggggtgaagaaaataaggat
ataatgaacgtgctatcggaagggtttgagcctactttcagcacgcatgcccaattactt
ctctctgaccgtatcacaggtaattttataattccatctggaaacgtttggaactacaca
tttatgggaacagcatttaaccaagaaggtgactacaattttaaatacggcattcctttg
gaattctataatgagatgcatcgtccagtacactttttacagtttagcgaattggcgggg
gacgaagagttagaggccgaacaaatcgatgtatttagctga

DBGET integrated database retrieval system