KEGG   Saccharomyces cerevisiae (budding yeast): YHR169WHelp
Entry
YHR169W           CDS       T00005                                 

Gene name
DBP8
Definition
(RefSeq) ATP-dependent RNA helicase DBP8
  KO
K14778  ATP-dependent RNA helicase DDX49/DBP8 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YHR169W (DBP8)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YHR169W (DBP8)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  90S particles
   Helicases
    YHR169W (DBP8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII
Motif
Other DBs
NCBI-GeneID: 856574
NCBI-ProteinID: NP_012039
SGD: S000001212
UniProt: P38719
Position
VIII:442181..443476
Genome map
AA seq 431 aa AA seqDB search
MADFKSLGLSKWLTESLRAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPM
LTKWSEDPSGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVIVGGESIVQQALDLQRK
PHFIIATPGRLAHHIMSSGDDTVGGLMRAKYLVLDEADILLTSTFADHLATCISALPPKD
KRQTLLFTATITDQVKSLQNAPVQKGKPPLFAYQVESVDNVAIPSTLKIEYILVPEHVKE
AYLYQLLTCEEYENKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRF
RANAARILIATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFVTQ
RDVSRIQAIEDRINKKMTETNKVHDTAVIRKALTKVTKAKRESLMAMQKENFGERKRQQK
KKQNDGKSLRS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcagactttaaatctttaggtctttcaaaatggcttacggaatccttaagagctatg
aaaattactcagccaaccgctatccaaaaggcttgtattcccaaaatcttagaaggaaga
gattgtattggtggtgccaagactggttctggtaaaactattgcatttgcagggcctatg
ctgactaaatggtccgaagatccgtcagggatgtttggagtggtcttgaccccaaccaga
gagttagccatgcaaattgccgaacaatttactgcacttggtagcagtatgaacattcgc
gtgtcagttatagttggtggtgaaagcatcgttcagcaggcattggatttacaaaggaag
ccgcactttattattgccacgcctggacgtctggcacatcatatcatgagcagcggagat
gataccgttggagggctaatgagagctaaatatttagttctagatgaagccgatattttg
ctaactagcacgtttgccgatcatttagcaacatgtataagtgctctacctcccaaggat
aagagacaaacacttctattcactgcaactataacggaccaagtaaagtcgttacaaaat
gcaccagtgcagaaagggaaacccccattgttcgcttaccaagtagaaagtgtagataat
gtggctattccatcgacgttgaaaatagagtatatcttggttccagaacacgtcaaagaa
gcatatttgtaccaattattaacatgcgaggaatatgagaataaaaccgctataatattt
gtaaatagaacaatgaccgcggagatccttagaagaaccctgaagcagttggaagtgagg
gtagcgtcgttgcactctcaaatgccccaacaggaaagaacaaattccttacatagattt
cgagctaacgctgcaagaatcctcatcgctacagatgtagcatccagaggtttggatatc
ccaactgttgagcttgtagtgaattacgatataccttcagacccagatgtattcatccat
agatctggtcgtacggcccgtgctggcagaattggtgacgccatatcattcgttacccag
cgagatgtttctaggatacaggccattgaggaccgtatcaacaagaagatgacagagaca
aacaaggtacacgataccgctgtaataagaaaagccttgaccaaggtaaccaaggcgaag
agggaatcgctgatggcaatgcaaaaggaaaacttcggtgagagaaaaagacagcaaaag
aagaagcaaaatgacgggaaaagtttgcgctcttga

DBGET integrated database retrieval system