KEGG   Saccharomyces cerevisiae (budding yeast): YHR170WHelp
Entry
YHR170W           CDS       T00005                                 

Gene name
NMD3, SRC5
Definition
(RefSeq) ribosome-binding protein NMD3
  KO
K07562  nonsense-mediated mRNA decay protein 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03008  Ribosome biogenesis in eukaryotes
sce03013  RNA transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    YHR170W (NMD3)
   03008 Ribosome biogenesis in eukaryotes
    YHR170W (NMD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YHR170W (NMD3)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    YHR170W (NMD3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMD3 Nif11
Motif
Other DBs
NCBI-GeneID: 856575
NCBI-ProteinID: NP_012040
SGD: S000001213
UniProt: P38861
Position
VIII:443828..445384
Genome map
AA seq 518 aa AA seqDB search
MEFTPIDPHQHQNAATLLCCNCGTPIDGSTGLVMCYDCIKLTVDITQGIPREANISFCRN
CERFLQPPGQWIRAELESRELLAICLRRLKGLTKVRLVDASFIWTEPHSRRIRIKLTVQG
EAMTNTIIQQTFEVEYIVIAMQCPDCARSYTTNTWRATVQIRQKVPHKRTFLFLEQLILK
HNAHVDTISISEAKDGLDFFYAQKNHAVKMIDFLNAVVPIKHKKSEELISQDTHTGASTY
KFSYSVEIVPICKDDLVVLPKKLAKSMGNISQFVLCSKISNTVQFMDPTTLQTADLSPSV
YWRAPFNALADVTQLVEFIVLDVDSTGISRGNRVLADITVARTSDLGVNDQVYYVRSHLG
GICHAGDSVMGYFIANSNYNSDLFDGLNIDYVPDVVLVKKLYQRKSKKSRHWKLKRMAKE
HKDIDASLDYNSRAQKQEMERAEKDYELFLQELEEDAELRQSVNLYKNREANVPPEEHEM
DEDEDEDAPQINIDELLDELDEMTLEDGVENTPVESQQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggaattcacacctatagatccgcaccagcaccaaaatgctgctactcttctatgttgt
aactgtggtaccccaatcgatgggtccactgggctggttatgtgttatgactgtatcaaa
ctgactgtggacattactcaaggtattccaagagaagcgaacatttcattttgcagaaac
tgtgaaagatttttgcaaccacctggacaatggatcagagcagaattagaatctagagaa
ttactggccatttgtttgcgtcgtttgaagggcctaacaaaagtcagattagtggatgct
tcattcatttggacagaaccccattctagacgtattagaattaaacttaccgtgcaggga
gaagccatgacaaatactattattcagcaaactttcgaagtagaatacattgttattgcg
atgcaatgtccagactgtgccagatcctacactacaaatacttggagggctactgtccaa
attagacaaaaagtgcctcacaagagaacatttttgtttttggaacaactgattttgaaa
cataatgctcatgtggataccatttccattagtgaagctaaggacgggttggatttcttc
tatgcgcaaaaaaaccacgcagttaagatgattgattttttgaacgctgttgttccgatt
aaacataaaaagtctgaagaacttatttctcaagatacacatactggtgcatctacttat
aaattttcatattctgtcgagattgttcctatctgtaaagatgacttggtcgttttacca
aaaaaactggctaaatctatgggtaacatttctcaatttgttctatgttctaagatttct
aacactgtccagtttatggatccgactactttgcaaaccgcggatctgtcaccatctgtg
tactggagggctccattcaacgccctggctgatgtgacccagttggtggagttcattgtt
ctggacgtggattctacaggtataagcaggggaaatcgtgtcttagctgacattactgtt
gctagaacgtctgacttgggtgttaatgaccaagtctactacgtcaggtctcatctcggt
ggtatttgccatgcaggtgatagtgttatgggttatttcattgcaaactcgaattacaac
tcagatctttttgatgggttaaatatcgattatgtgcctgatgtagttcttgtgaagaaa
ttgtatcaaagaaagagcaaaaagagcagacactggaagttaaagagaatggctaaggaa
cacaaagatatcgatgcatccttagattacaattcaagagctcaaaagcaagaaatggaa
cgtgcagaaaaggactacgaattattcttacaagaattagaagaggatgctgaattaaga
caaagtgttaacctatacaaaaaccgcgaagcaaatgtacctcctgaagagcatgaaatg
gatgaagacgaggatgaagacgctccacaaatcaacattgatgaattattggacgagtta
gatgaaatgacattagaagatggagtcgagaacacacccgttgaatctcagcagtaa

DBGET integrated database retrieval system