KEGG   Saccharomyces cerevisiae (budding yeast): YHR171W
Entry
YHR171W           CDS       T00005                                 

Gene name
ATG7, APG11, APG7, CVT2
Definition
(RefSeq) Atg7p
  KO
K08337  ubiquitin-like modifier-activating enzyme ATG7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04136  Autophagy - other
sce04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YHR171W (ATG7)
   04136 Autophagy - other
    YHR171W (ATG7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YHR171W (ATG7)
   04121 Ubiquitin system [BR:sce04121]
    YHR171W (ATG7)
   03029 Mitochondrial biogenesis [BR:sce03029]
    YHR171W (ATG7)
Membrane trafficking [BR:sce04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    YHR171W (ATG7)
   Atg8 conjugation proteins
    YHR171W (ATG7)
Ubiquitin system [BR:sce04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   YHR171W (ATG7)
Mitochondrial biogenesis [BR:sce03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    YHR171W (ATG7)
SSDB
Motif
Pfam: ATG7_N ThiF Shikimate_DH
Other DBs
NCBI-GeneID: 856576
NCBI-ProteinID: NP_012041
SGD: S000001214
UniProt: P38862
Structure
PDB: 

Position
VIII:445713..447605
AA seq 630 aa
MSSERVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQVPL
FLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDGIKDINKC
VSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVRPEPSLKGLFSKCQKWFDVNYSKWV
CILDADDEIVNYDKCIIRKTKVLAIRDTSTMENVPSALTKNFLSVLQYDVPDLIDFKLLI
IRQNEGSFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVVDLSSLLDPLKIADQ
SVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVS
YSNPVRQALYNFEDCGKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNEEAQHKDF
DRLRALIKEHDIIFLLVDSRESRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRDEQSS
KQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSETT
VLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPLYLEE
ISGLSVIKQEVERLGNDVFEWEDDESDEIA
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgtcgtcagaaagggtcttaagttatgcaccagcttttaaatcatttctggatacatct
tttttccaagaattatcgagattgaaactcgatgttctgaaattagattcaacatgccaa
ccacttactgtgaatctagatttacacaacattcctaaatctgctgatcaagttccatta
ttcttaacaaatagaagctttgaaaaacacaataataagcgtactaatgaagtgccttta
cagggcagtattttcaattttaatgtattagacgagtttaagaatcttgataagcaacta
tttttacatcaaagagcattggaatgctgggaagatggaataaaggatatcaataagtgt
gtttcttttgtgattattagttttgctgacctaaaaaagtacaggttttattactggtta
ggtgttccctgttttcaaagaccctcttcaacagttttacatgtgcggccagagccgagt
ttaaaagggctgttctcaaagtgtcaaaaatggtttgatgtcaattactcaaaatgggtg
tgtatactggatgcagacgatgaaatagtaaattatgacaagtgtattattcgaaaaact
aaagttttggcgataagggacactagtacgatggaaaacgtcccttctgctctaaccaaa
aattttctcagcgtgttgcaatacgatgttcctgacttgatagatttcaaactattaatt
attagacagaacgaaggtagctttgcattaaatgctacatttgcttctattgacccacaa
tcatcctcaagtaacccagatatgaaagtttctggatgggaaaggaatgtgcaaggtaag
ctagcaccacgtgttgttgatttaagttcattgttagatcctttaaaaattgctgaccaa
tccgtggatttaaatttgaagctaatgaaatggagaattcttcctgacttaaatctagat
atcatcaaaaacacaaaagtactactactaggtgctggtacactaggttgttatgtttca
cgcgcattgatagcatggggggttagaaaaataacatttgtggataacggtacagtttca
tattcaaatccagtgaggcaagcgttatataattttgaggactgtggaaagccaaaggca
gaacttgcggctgcgtctttgaaaagaatatttcctttaatggacgctactggtgtgaaa
ttaagtattcctatgatcggtcataaattagtaaacgaggaggctcagcataaggatttt
gatagattaagagcattaataaaagagcatgatatcatttttttattggtggattctcga
gaaagcagatggcttccgtcgttattgagcaacatcgaaaacaaaaccgttattaatgct
gctctggggtttgatagctacttagttatgaggcatggtaatagagatgaacagtcttca
aaacaactgggctgttatttttgccatgatgtggtagcaccaactgacagtttaactgac
aggactttggatcaaatgtgcacagtaactagacccggcgttgctatgatggcctcttct
ttagcagttgaattgatgacttccttactacagaccaaatactctggttcagaaacaaca
gtattaggggatatacctcatcaaatacgtgggtttttgcataatttttccatcttaaaa
ttagaaactccagcctatgagcattgtccagcatgtagccctaaagttatcgaagcattt
acagacttaggttgggaatttgttaaaaaggccttggagcatccactttaccttgaagaa
attagcggtttgtcagtcataaagcaggaggtcgaacgactaggcaacgatgtttttgaa
tgggaagatgatgaatctgatgagattgcttaa

DBGET integrated database retrieval system