KEGG   Saccharomyces cerevisiae (budding yeast): YHR172WHelp
Entry
YHR172W           CDS       T00005                                 

Gene name
SPC97
Definition
(RefSeq) Spc97p
  KO
K16569  gamma-tubulin complex component 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YHR172W (SPC97)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YHR172W (SPC97)
   04147 Exosome [BR:sce04147]
    YHR172W (SPC97)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     YHR172W (SPC97)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Gamma-tubulin complex components
     YHR172W (SPC97)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YHR172W (SPC97)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCP_N_terminal GCP_C_terminal RWD
Motif
Other DBs
NCBI-GeneID: 856577
NCBI-ProteinID: NP_012042
SGD: S000001215
UniProt: P38863
Structure
PDB: 

Position
VIII:448335..450806
Genome map
AA seq 823 aa AA seqDB search
MEIKEVDDRAELLRYTNNIPLLGKLVNHQPLWSTNPKLKSFSLEKISAPDQRRVQEALVV
KDLLNVLIGLEGTYIRYFNDYEPSDPETPIEFKIAKKMDPSFKTFSRRIVRYGKQYMILT
RAYEKWSDTSFGMVLQRFAYEIRRFLEDVYLKTLVERLERDFNKVPNFSIRELEQIINET
EVNKQMELLYNIYEEIFREIEERRTNQSSQEDFNNFMDSMKNESSLHLRLMVAFDTTVYP
VPKGGAILKIFQQKILENLGDRSSVMFLKKLLNNISQDYCTMLYEWLTQGILNDPYQEFM
TYDDLEGKTDNIFDTRDRAWDTQYFIRKDVLLRDCDSEEDKNLLFKMLRTGILLKVVRAS
LQIPTIPSNSSDITIQEINDFADLMEGSNLELYVDKCYSRANEIFLKLFFQGYDLINVLK
HLQQIFLGYQSGHNVLKFLTKNMGELTKHYRNDNNANYDKLLQNFELERQSENPNNLMRQ
LLMIQFDTETLPQVLSHYLQIYPEVPENNSANDDSDPLMHANNFKNMNAILFDELSKERT
GAYHGSNLELYTPKSAIYHLKFDINIPYPLNIIISRTCMIKYQIILRYQLVLQYHSRLLD
ETWMDLNKTPSWKYRGYSHTVKRRIVRATRVLHAKMNHFIKTIMEYFNQNVIDKEVYSLE
KCYRNPTLAVAIQNELEGGLTNIMTNRCLSDLIPLQLQIFDIVYKFCKFIKSMRAKLCQL
DPVLYEKHKSGMMKTLNEGYRTNNGGQEDVGYQEDAALELIQKLIEYISNASSIFRKCLI
NFTQELSTEKFDFYDSSSVDAAGIERVLYSIVPPRSASASSQR
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaaagaggtagatgacagggcagagctactgagatataccaacaatattccg
ttacttggaaagctagtcaaccatcaaccattatggagtacaaatcctaagttaaagtcc
ttttcgctagaaaaaatatcagcccctgatcaaaggcgtgtacaagaggcattagttgta
aaagacctattaaatgtattgattggacttgaaggaacatacatcagatattttaatgat
tatgaacctagtgacccagagacaccgatagaatttaagattgccaagaaaatggatcca
tcattcaaaacattcagtagaagaattgttaggtatggtaagcaatacatgatattaaca
agggcgtatgaaaaatggtctgacacaagctttgggatggttttgcaaagatttgcttat
gaaatcagaagattcttagaagacgtctacttaaaaacgttagttgaaaggcttgaaagg
gactttaacaaagtgccaaacttttctatcagagaactagaacaaatcattaatgaaaca
gaagtaaacaaacaaatggagttgctgtacaatatttatgaagaaatttttagagaaata
gaagaaagaaggacgaaccaatcttcacaagaagatttcaataattttatggacagtatg
aagaatgaaagcagcttgcacttacgattaatggtagcatttgacacaacagtatatccg
gtacccaaaggtggtgccatattgaaaatttttcagcaaaaaatactggaaaatttgggt
gataggtcaagcgtaatgtttttgaagaagctattgaataatataagccaagactattgc
acaatgctgtatgaatggctaacacagggtattttaaacgacccttaccaagaattcatg
acttatgatgatttggaaggtaagacggataacatatttgacacaagagacagagcgtgg
gatacgcaatacttcataagaaaagatgttttgttgcgggattgtgactcagaagaggat
aagaatctactattcaagatgttaaggaccggtattttactcaaagttgttcgagctagc
ttacaaatacccaccataccttctaatagcagtgatataaccattcaagaaatcaatgat
ttcgctgacttaatggagggttctaatcttgaactttacgtggataaatgttacagcaga
gccaatgaaatatttttaaagctattttttcaaggttacgatttgatcaatgtattaaaa
catttgcaacaaatttttcttgggtatcaatctggtcataatgttttaaagtttctaaca
aaaaatatgggtgagttgaccaaacactacaggaatgataataatgcaaactatgacaag
ctgctacaaaattttgagttagagagacaatccgaaaatccaaacaacctgatgaggcaa
ctcctgatgatacagttcgatacagaaacacttccacaagtcttatcgcactacctccaa
atttatccagaagtacctgagaataactcagcaaatgacgacagcgacccattgatgcac
gcgaataatttcaagaatatgaatgccattctttttgatgaattaagcaaagaacgaacg
ggagcctaccatggatccaatctagaactatatactccaaaaagcgcaatttatcattta
aaatttgacatcaacataccttatccattgaatattattattagtaggacatgcatgata
aaataccaaataatcctgcgctaccaactagttttacaataccactcaaggcttttggat
gagacttggatggacttaaacaaaacacccagctggaaatacagaggctattcgcacact
gtgaagaggaggatagtaagggcaacgagagtgctgcatgctaagatgaaccacttcatt
aaaaccatcatggaatatttcaaccaaaacgtaattgataaagaggtatactcattagaa
aagtgctacagaaatcctactcttgccgttgccatccaaaatgagctagaaggtggatta
acaaatataatgacaaatcgttgcttgtctgacttgattccactacagttacaaatattt
gacattgtatataagttttgcaagttcatcaaatctatgagagcaaaattatgtcaactg
gaccccgtactatatgagaaacacaaaagcgggatgatgaaaacactaaacgaaggctat
cgtacaaacaatggcggtcaggaagatgttggttaccaagaagatgccgccctggaatta
attcagaagctgattgaatacattagcaacgcgtccagcatttttcggaagtgtctcata
aactttactcaagagttaagtactgaaaaattcgacttttatgatagttcaagtgtcgac
gctgcgggtatagaaagggttctttactctatagtacctcctcgctcagcatctgcttct
tcccaaagatga

DBGET integrated database retrieval system