KEGG   Saccharomyces cerevisiae (budding yeast): YHR179WHelp
Entry
YHR179W           CDS       T00005                                 

Gene name
OYE2
Definition
(RefSeq) NADPH dehydrogenase
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YHR179W (OYE2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     YHR179W (OYE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Ribosomal_L30_N
Motif
Other DBs
NCBI-GeneID: 856584
NCBI-ProteinID: NP_012049
SGD: S000001222
UniProt: Q03558
Position
VIII:462502..463704
Genome map
AA seq 400 aa AA seqDB search
MPFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRAQHPGNIPNRDWAVEYYAQ
RAQRPGTLIITEGTFPSPQSGGYDNAPGIWSEEQIKEWTKIFKAIHENKSFAWVQLWVLG
WAAFPDTLARDGLRYDSASDNVYMNAEQEEKAKKANNPQHSITKDEIKQYVKEYVQAAKN
SIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTLEVVDAVVDAIGPEK
VGLRLSPYGVFNSMSGGAETGIVAQYAYVLGELERRAKAGKRLAFVHLVEPRVTNPFLTE
GEGEYNGGSNKFAYSIWKGPIIRAGNFALHPEVVREEVKDPRTLIGYGRFFISNPDLVDR
LEKGLPLNKYDRDTFYKMSAEGYIDYPTYEEALKLGWDKN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgttaaggactttaagccacaagctttgggtgacaccaacttattcaaacca
atcaaaattggtaacaatgaacttctacaccgtgctgtcattcctccattgactagaatg
agagcccaacatccaggtaatattccaaacagagactgggccgttgaatactacgctcaa
cgtgctcaaagaccaggaaccttgattatcactgaaggtacctttccctctccacaatct
gggggttacgacaatgctccaggtatctggtccgaagaacaaattaaagaatggaccaag
attttcaaggctattcatgagaataaatcgttcgcatgggtccaattatgggttctaggt
tgggctgctttcccagacacccttgctagggatggtttgcgttacgactccgcttctgac
aacgtgtatatgaatgcagaacaagaagaaaaggctaagaaggctaacaacccacaacac
agtataacaaaggatgaaattaagcaatacgtcaaagaatacgtccaagctgccaaaaac
tccattgctgctggtgccgatggtgttgaaatccacagcgctaacggttacttgttgaac
cagttcttggacccacactccaataacagaaccgatgagtatggtggatccatcgaaaac
agagcccgtttcaccttggaagtggttgatgcagttgtcgatgctattggccctgaaaaa
gtcggtttgagattgtctccatatggtgtcttcaacagtatgtctggtggtgctgaaacc
ggtattgttgctcaatatgcttatgtcttaggtgaactagaaagaagagctaaagctggc
aagcgtttggctttcgtccatctagttgaacctcgtgtcaccaacccatttttaactgaa
ggtgaaggtgaatacaatggaggtagcaacaaatttgcttattctatctggaagggccca
attattagagctggtaactttgctctgcacccagaagttgtcagagaagaggtgaaggat
cctagaacattgatcggttacggtagattttttatctctaatccagatttggttgatcgt
ttggaaaaagggttaccattaaacaaatatgacagagacactttctacaaaatgtcagct
gagggatacattgactaccctacgtacgaagaagctctaaaactcggttgggacaaaaat
taa

DBGET integrated database retrieval system