KEGG   Saccharomyces cerevisiae (budding yeast): YHR188CHelp
Entry
YHR188C           CDS       T00005                                 

Gene name
GPI16
Definition
(RefSeq) GPI-anchor transamidase subunit GPI16
  KO
K05292  GPI-anchor transamidase subunit T
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    YHR188C (GPI16)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 856595
NCBI-ProteinID: NP_012058
SGD: S000001231
UniProt: P38875
Position
VIII:complement(482005..483837)
Genome map
AA seq 610 aa AA seqDB search
MILTLAYFMLGTLLLGVFAEDTVSQIGINDSLWYPYDEALVLKPLPNNDLLLSFAFQLQS
EPFDPAVSSMSYDAYEHYTTFPRAIPPLLESTATRQFHLRFTRGFWDALSWGQLPHAGKE
AGASGVELWSQVQAMDQEQAFHNWKKLSNSLSGLFCSSLNFIDESRTTFPRRSYASDIGA
PLFNSTEKLYLMRASLPNEPICTENLTPFIKLLPTRGKSGLTSLLDGHKLFDSLWNSISL
DIATICSEDEDALCHYEMDARIEMVTHVPSALARGERPIPKPLDGNTLRCDTDKPFDSYQ
CFPLPEPSQTHFKLSQLFARPINNGNLFANRPTRICAEVDRSTWTAFLSVDDTIFSTHDN
CFDLSNDQNEGGSGYDFILESTDTTKVTPIVPVPIHVSRSLTGNGQDRGGMRIVFHNDND
TPVKLIYFESLPWFMRVYLSSLQITSTTSPQLQENDIILDKYYLQAADRKRPGHLEFTML
IPANTDIVMTYQFDKALLQFAEYPPDANHGFEIDAAVITVLSLESSSSLYEMRTSTLLLS
LSTPDFSMPYNVIILTSTIMGLIFGMLYNLMVKRMVTVEEADKITLQSGLKYKLLKLKEK
FLGKKKTKTD
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcacactggcctatttcatgctgggcactctactactgggtgtgttcgcagaa
gacacggtgtcgcagattggtataaatgacagtttatggtatccgtacgacgaagcactg
gtgttgaagccgctgcccaacaatgatctgctactctcatttgcattccaactgcaatcg
gaaccgtttgacccggccgtatcatccatgtcatatgatgcgtatgagcactacacgact
ttcccacgggccatcccaccattgttggaatctactgccacgcgtcagtttcatttaaga
tttaccagaggattctgggatgccctgtcgtggggacagttgccacatgctggaaaagag
gcaggtgcctcaggtgtggaattgtggtcgcaagtgcaggccatggatcaggaacaggcg
ttccataattggaaaaaactgtccaattcattgagcggattgttttgttcttctttaaat
tttatcgacgagtcaaggacgacctttccccggcggtcatatgcttctgatataggagct
cctcttttcaatagcaccgagaaactgtacctgatgcgagcatcgttgcccaatgaaccc
atctgtaccgagaacttgacgccgttcataaaactattgcctactaggggcaaatccggt
ttgacatctctcttggatggtcataaattgttcgactctctatggaatagtatttccttg
gatattgccactatttgttctgaagatgaagatgctctttgtcactacgagatggacgca
cgcatagaaatggtaacacacgttccctccgccttggcaagaggtgagagacctatcccc
aaacctttggatgggaacacattgcgttgtgacacggataaaccctttgattcttaccaa
tgcttccctctaccggaaccttcgcagactcacttcaagctgtctcagctgtttgccaga
ccaataaacaatggcaacctgtttgctaataggcccacaagaatttgtgcagaagttgac
cgttctacctggactgcgtttttgtcagttgacgatactattttcagcacacatgataat
tgctttgacttatcaaacgatcaaaatgagggtggttcgggctacgactttattttagaa
tcgacggacactactaaagttactcccatagttcctgtcccaattcacgtaagcagatct
ctgactggtaatggacaagatcgtggtggaatgcgtattgttttccataacgacaatgat
acccctgtgaagttgatttatttcgaatcattgccatggttcatgagagtttacctatcc
tctcttcaaattacttctactacctctccgcaattgcaagaaaacgatatcatcttagat
aaatactatttacaagcggccgatagaaaaagacctggccacttggagttcacgatgtta
attccagctaatacggacattgtaatgacttatcaattcgataaagctcttctgcaattt
gccgagtatccaccagatgcaaaccatggttttgaaatcgatgcagctgtaatcaccgtg
ctatctttggagtcctcatcgtctctttatgaaatgagaacctctaccctattgttatcc
ctgtctacaccggattttagtatgccgtataacgtcatcattctaacatctacaatcatg
ggactcatattcggtatgctatacaatttgatggtgaagagaatggtcaccgtcgaagag
gccgataagattacgttgcaatctggcttaaaatacaaattgctaaagctaaaggaaaag
ttcctagggaaaaaaaagactaaaacagactaa

DBGET integrated database retrieval system