KEGG   Saccharomyces cerevisiae (budding yeast): YHR200WHelp
Entry
YHR200W           CDS       T00005                                 

Gene name
RPN10, MCB1, SUN1
Definition
(RefSeq) proteasome regulatory particle base subunit RPN10
  KO
K03029  26S proteasome regulatory subunit N10
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03050  Proteasome
Module
sce_M00341  Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    YHR200W (RPN10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YHR200W (RPN10)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     YHR200W (RPN10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Ssl1 VWA
Motif
Other DBs
NCBI-GeneID: 856607
NCBI-ProteinID: NP_012070
SGD: S000001243
UniProt: P38886
Structure
PDB: 

Position
VIII:499079..499885
Genome map
AA seq 268 aa AA seqDB search
MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPR
VLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISD
SRDELIRLAKTLKKNNVAVDIINFGEIEQNTELLDEFIAAVNNPQEETSHLLTVTPGPRL
LYENIASSPIILEEGSSGMGAFGGSGGDSDANGTFMDFGVDPSMDPELAMALRLSMEEEQ
QRQERLRQQQQQQDQPEQSEQPEQHQDK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggtattggaagctacagtgttagtgattgataattcagagtactctcgcaatggcgac
tttcctaggacaaggtttgaagcccagatcgactcggtagagttcatatttcaagccaag
agaaacagcaatcctgagaatacagtgggtcttatctctggtgctggcgccaaccccagg
gtgttatctacgtttaccgccgagtttgggaagattcttgctggactacacgacacgcag
atcgagggtaagctgcatatggccactgcgttgcagatcgctcagctgactttgaagcat
cgccagaataaggtccaacatcaaaggattgtggcatttgtgtgtagcccaataagtgat
tctcgagacgaattgatcagattggcaaaaacactgaaaaagaataatgttgccgtggac
atcatcaattttggagagattgaacagaacacggagcttttggatgagttcatagctgca
gtgaacaaccctcaagaagaaactagtcatttgcttactgtgacgcctggccccagactg
ctgtacgagaacatcgcatcttcacccataattctcgaagaaggatcctccggtatgggc
gcctttggtgggtctggcggtgattccgatgccaatggcacatttatggacttcggggta
gacccatcaatggacccagaactggcaatggccttgcgtctgtctatggaagaagagcag
caaagacaggaaaggttaagacagcagcaacaacaacaagatcagcctgagcagtctgaa
cagcctgaacaacaccaagacaaatag

DBGET integrated database retrieval system