KEGG   Saccharomyces cerevisiae (budding yeast): YHR201CHelp
Entry
YHR201C           CDS       T00005                                 

Gene name
PPX1
Definition
(RefSeq) exopolyphosphatase
  KO
K01514  exopolyphosphatase [EC:3.6.1.11]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YHR201C (PPX1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     YHR201C (PPX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHHA2 DHH
Motif
Other DBs
NCBI-GeneID: 856608
NCBI-ProteinID: NP_012071
SGD: S000001244
UniProt: P38698
Structure
PDB: 

Position
VIII:complement(499950..501143)
Genome map
AA seq 397 aa AA seqDB search
MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGT
YSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTE
LNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEK
LQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDS
SEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGG
EADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQL
FGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctttgagaaagacggttcctgaatttttggcacacttaaaatcactgccaatt
tcaaaaattgcaagcaacgatgtgttaacaatatgtgttggtaacgagtcagcagatatg
gactcaattgctagtgcaatcacttattcgtactgccaatacatatataatgaaggtact
tactcggaggagaaaaagaaaggaagctttattgtcccaattatcgacattcctagagaa
gacctcagtttaagaagagacgtaatgtatgtcctagaaaaactgaaaattaaggaggag
gaattattcttcattgaagatttaaagagcttgaagcaaaatgtctcccagggtactgaa
ttaaactcttacttggtagataataacgatacaccaaagaatttgaaaaattatatagat
aacgtcgttggcattatagaccaccattttgacttgcaaaaacatttggatgctgaacct
cggattgtaaaagtgtccggcagttgctcatcgctggtttttaactactggtatgaaaaa
ttgcaaggtgaccgtgaagtggtgatgaacattgcaccacttttgatgggggccatctta
atagacacttcaaatatgaggcgcaaagtcgaggaaagtgataaattagctatcgagaga
tgccaagctgttcttagtggtgcggttaatgaagtgtctgcgcaaggtttagaggacagc
agtgagttttataaagagataaaatcaagaaagaacgatattaaaggattttcggtaagc
gatattctaaagaaggactacaaacaattcaatttccaaggaaagggacacaaagggtta
gagattggtctttcatcaatagtaaaaagaatgtcttggctattcaatgaacacggtggt
gaagcagatttcgtcaaccaatgcagaagatttcaggcggagagggggctcgatgtattg
gttctgttgacttcatggaggaaagctggtgattcacacagagaattggtcatattggga
gactctaacgtggtacgtgaactcattgaaagggttagcgacaagctccaacttcaatta
tttgggggcaatcttgatggaggtgtggcgatgtttaagcaactgaacgtcgaggccacc
agaaagcaagtcgtcccctatttagaggaagcgtactcaaacctggaagagtga

DBGET integrated database retrieval system