KEGG   Saccharomyces cerevisiae (budding yeast): YHR203CHelp
Entry
YHR203C           CDS       T00005                                 

Gene name
RPS4B
Definition
(RefSeq) ribosomal 40S subunit protein S4B
  KO
K02987  small subunit ribosomal protein S4e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YHR203C (RPS4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YHR203C (RPS4B)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YHR203C (RPS4B)
  Archaea
    YHR203C (RPS4B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S4e 40S_S4_C RS4NT S4 KOW Sipho_tail dCache_2
Motif
Other DBs
NCBI-GeneID: 856610
NCBI-ProteinID: NP_012073
SGD: S000001246
UniProt: P0CX35 P0CX36
Structure
PDB: 

Position
VIII:complement(join(504476..505247,505517..505530))
Genome map
AA seq 261 aa AA seqDB search
MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGRE
VKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRLVYDVKGRFAVHRITDEEAS
YKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTVKIDLASGKITDFIKFDAGKL
VYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPK
GKGIKLSIAEERDRRRAQQGL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctagaggaccaaagaagcatctaaagagattagcagctccacaccattggttattg
gacaagttgtccggttgttacgccccaagaccatctgctggtccacacaaattgcgtgaa
tccttgccattgattgtctttctaagaaacagattaaagtatgctttgaacggccgtgaa
gtcaaggctatcttgatgcaacgtcacgtcaaagttgacggtaaggttagaactgacacc
acctacccagctggtttcatggacgtcatcactctagatgccaccaatgaaaacttcaga
ttggtctacgatgtcaagggtagattcgctgtccaccgtatcaccgatgaagaagcctct
tacaaattgggtaaggtcaagaaggtccaattaggtaagaagggtgttccatacgttgtt
acccacgatggtagaactatcagatacccagacccaaacatcaaggtcaatgacactgtt
aagattgatttggcctctggtaagattactgatttcatcaagttcgatgccggtaagttg
gtttacgttactggtggtcgtaacttgggtcgtatcggtactatcgttcacaaggaaaga
cacgatggtggtttcgatttggttcacatcaaggactccttggacaacactttcgtcact
agattgaacaatgtcttcgtcattggtgaacaaggtaagccttacatttctttgccaaag
ggtaagggtatcaagttgtctattgctgaagaacgtgacagaagaagagctcaacaaggt
ttgtaa

DBGET integrated database retrieval system