KEGG   Saccharomyces cerevisiae (budding yeast): YHR205WHelp
Entry
YHR205W           CDS       T00005                                 

Gene name
SCH9, HRM2, KOM1
Definition
(RefSeq) serine/threonine protein kinase SCH9
  KO
K19800  serine/threonine protein kinase SCH9 [EC:2.7.11.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04138  Autophagy - yeast
sce04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    YHR205W (SCH9)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    YHR205W (SCH9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YHR205W (SCH9)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     YHR205W (SCH9)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   YHR205W (SCH9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C C2 Haspin_kinase FTA2 Adeno_E3_15_3
Motif
Other DBs
NCBI-GeneID: 856612
NCBI-ProteinID: NP_012075
SGD: S000001248
UniProt: P11792
Position
VIII:509363..511837
Genome map
AA seq 824 aa AA seqDB search
MMNFFTSKSSNQDTGFSSQHQHPNGQNNGNNNSSTAGNDNGYPCKLVSSGPCASSNNGAL
FTNFTLQTATPTTAISQDLYAMGTTGITSENALFQMKSMNNGISSVNNNNSNTPTIITTS
QEETNAGNVHGDTGGNSLQNSEDDNFSSSSTTKCLLSSTSSLSINQREAAAAAYGPDTDI
PRGKLEVTIIEARDLVTRSKDSQPYVVCTFESSEFISNGPESLGAINNNNNNNNNNQHNQ
NQHINNNNENTNPDAASQHHNNNSGWNGSQLPSIKEHLKKKPLYTHRSSSQLDQLNSCSS
VTDPSKRSSNSSSGSSNGPKNDSSHPIWHHKTTFDVLGSHSELDISVYDAAHDHMFLGQV
RLYPMIHNLAHASQHQWHSLKPRVIDEVVSGDILIKWTYKQTKKRHYGPQDFEVLRLLGK
GTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKF
SFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLK
PENILLDANGNIALCDFGLSKADLKDRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGV
LIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAID
DGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMM
TATPLSPAMQAKFAGFTFVDESAIDEHVNNNRKFLQNSYFMEPGSFIPGNPNLPPDEDVI
DDDGDEDINDGFNQEKNMNNSHSQMDFDGDQHMDDEFVSGRFEI
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttttttacatcaaaatcgtcgaatcaggatactggatttagctctcaacac
caacatccaaatggacagaacaatggaaacaataatagcagcaccgctggcaacgacaac
ggatacccatgtaaactggtgtccagtgggccctgcgcttcatcaaataatggtgccctt
tttacgaattttactttacaaactgcaacgccgaccaccgctattagtcaggacttatat
gcaatgggcacaacaggaataacatcagaaaatgccctttttcaaatgaagtcaatgaat
aatggaatatcatcagttaataataacaacagcaacacccctacgattattaccacgtca
caggaagaaactaatgctggaaatgtacatggcgataccggtggcaattctttgcaaaat
tctgaagatgacaacttttcttccagttctaccaccaaatgcttactctcttccacttct
tcgctatcaataaatcaacgagaagcagcagcagctgcttatggtccagataccgatatt
cctaggggtaaactagaagttacaataatagaagcacgtgacctagtcactagatcaaag
gattcacagccttatgttgtttgtacttttgagagttcagagttcatttctaatggtcct
gagtcactaggcgccattaataataacaacaataacaacaacaataatcagcataatcaa
aaccagcatattaacaacaacaacgaaaataccaaccctgacgctgctagccagcatcat
aataataacagtggttggaacggttctcagttaccatcgataaaagagcacttgaagaaa
aaacccctttatacacacagatcatcttcccaattagatcagctaaactcttgctcttca
gtaaccgatccgagcaaacgttcttctaattcttcgtcgggttcttcaaatggtccaaag
aatgatagttcacatccaatatggcatcacaagacaacgtttgatgttttgggatctcac
tcggaattagatatttctgtttatgatgctgcccacgaccatatgttcttaggccaagtt
agactgtatccaatgattcataatttagcacatgcttcccaacaccaatggcacagtttg
aaacctcgcgttattgatgaagttgtgtccggtgatattttaatcaaatggacttacaaa
cagacaaagaaaagacattatggcccacaagattttgaagttcttcgattattgggtaag
ggtacttttggccaagtctaccaagttaagaagaaagacactcaaagaatttatgcaatg
aaagttctctccaagaaagttattgtcaagaaaaatgagatcgcccacacaattggcgaa
agaaatatcctagtcacgacagcgtccaaatcgtccccattcattgtcggattgaagttt
tcctttcaaacaccaacagatctgtatttggtcactgattatatgagtggtggagaatta
ttctggcatttacaaaaggagggccgtttttcggaagacagagcgaaattctatatcgct
gagttagtcctagcgttagaacatttacacgataacgatatcgtttacagggacctaaag
cctgaaaacattctactcgatgccaacggtaacatcgctctttgcgattttggtctttct
aaagctgacttgaaggatagaacaaacacattttgcggcaccacggaatacctggcacca
gaattgttactggacgaaaccggctacaccaaaatggtcgatttctggtctctaggtgtt
ttgatatttgaaatgtgttgtggttggtcccctttctttgcggaaaataatcaaaaaatg
taccaaaaaattgcctttggtaaagtcaaattccccagagacgtactgtcacaagagggg
aggtcttttgtaaagggtttactaaacagaaaccccaaacatagactcggtgccattgat
gatggaagagaactacgagctcatccatttttcgcagatatcgactgggaggccttgaag
cagaaaaaaattccaccacctttcaaacctcacctagtctcggagacggatacctcgaat
tttgacccagagttcacaacagcttcaacttcatacatgaacaagcaccagccgatgatg
actgctaccccgctatctccagccatgcaagcaaagtttgctggtttcacctttgttgat
gagtccgccatcgatgaacacgttaataacaacagaaaattcctacaaaactcgtacttt
atggaacctggttcctttatcccgggaaatccaaacttacctccagacgaagatgtcatc
gatgatgacggggacgaggacatcaatgatggattcaaccaagagaaaaatatgaacaac
agccattcgcagatggacttcgacggcgaccaacacatggatgacgaatttgtcagtgga
agattcgaaatatga

DBGET integrated database retrieval system