KEGG   Saccharomyces cerevisiae (budding yeast): YHR206WHelp
Entry
YHR206W           CDS       T00005                                 

Gene name
SKN7, BRY1, POS9
Definition
(RefSeq) kinase-regulated stress-responsive transcription factor SKN7
  KO
K15859  osomolarity two-component system, response regulator SKN7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Module
sce_M00516  SLN1-YPD1-SSK1/SKN7 (osmosensing) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sce02022]
    YHR206W (SKN7)
Two-component system [BR:sce02022]
 Other families
  SLN1-YPD1-SSK1/SKN7 [MD:M00516]
   YHR206W (SKN7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSF_DNA-bind Response_reg
Motif
Other DBs
NCBI-GeneID: 856613
NCBI-ProteinID: NP_012076
SGD: S000001249
UniProt: P38889
Position
VIII:512732..514600
Genome map
AA seq 622 aa AA seqDB search
MSFSTINSNVNKTTGDSNNNTTENSSTADLLGMDLLQSGPRLMNTMQPNNSSDMLHINNK
TNNVQQPAGNTNISSANAGAKAPANEFVRKLFRILENNEYPDIVTWTENGKSFVVLDTGK
FTTHILPNHFKHSNFASFVRQLNKYDFHKVKRSPEERQRCKYGEQSWEFQHPEFRVHYGK
GLDNIKRKIPAQRKVLLDESQKALLHFNSEGTNPNNPSGSLLNESTTELLLSNTVSKDAF
GNLRRRVDKLQKELDMSKMESYATKVELQKLNSKYNTVIESLITFKTINENLLNNFNTLC
STLANNGIEVPIFGDNGNRNPTGNTNPATTTAIQSNNNTNNASPATSTVSLQLPNLPDQN
SLTPNAQNNTVTLRKGFHVLLVEDDAVSIQLCSKFLRKYGCTVQVVSDGLSAISTLEKYR
YDLVLMDIVMPNLDGATATSIVRSFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFT
RDDLHSILIRYLKDRIPLCEQQLPPRNSSPQTHSNTNTANSNPNTINEQSLAMLPQDNPS
TTTPVTPGASISSAQHVQQGQQEQQHQIFHAQQQQQHHNAIANARSDVAIPNLEHEINTV
PHSSMGSTPQLPQSTLQENQLS
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttccaccataaatagcaacgtcaataaaaccaccggcgatagcaataataac
accaccgagaacagttcgactgcagaccttttaggaatggacttgttgcagagcgggcct
cgactgatgaacacgatgcagccaaacaactcttctgacatgctgcacattaacaacaag
actaataacgttcaacaaccagctggaaacacaaatatcagcagtgctaatgcgggagca
aaggctccagcaaatgagttcgtaagaaaactgttcaggatactggaaaacaatgaatat
cctgacattgtaacttggactgagaacggcaaaagtttcgtcgttttggacacaggaaag
ttcactacgcatatattgcctaatcacttcaaacattcaaattttgcatcttttgtaagg
caactaaacaagtatgactttcacaaggttaagagaagtcccgaggaaagacagagatgt
aaatatggcgaacaaagttgggagtttcagcatccagaatttagagtccattacggaaaa
ggtctcgataacatcaaaaggaaaattccggcgcaaaggaaagtgcttttggatgaatct
caaaaggctcttttgcatttcaatagtgaaggcactaaccccaacaatccttctgggtct
cttttgaatgaatccaccacagagctgttgttaagcaataccgtaagtaaagatgcattt
ggaaatctaagaaggcgagtagacaaactacaaaaggagttggatatgtccaaaatggag
agttatgctactaaagtagaactacaaaagttgaactcgaaatacaatacggttatcgaa
agtttgataacattcaagaccataaatgaaaatttactcaacaacttcaacactctgtgt
tccactttggcaaataatggtattgaagtgccaatatttggcgacaatggaaaccgtaac
ccaactggtaataccaacccagcaacaacaacagctatccaaagcaacaacaacaccaac
aatgcttctccggcaacatctacagtttccttacaactacctaatttacccgatcagaat
agcctaacaccaaatgctcaaaataacacagtcacgctacgaaaaggtttccatgtactg
ttggtggaagatgacgcagtgtctatacagttgtgttcaaaatttttacggaaatatggc
tgtactgtccaagttgtcagcgacggtctttcagctatctcaacactagagaagtatagg
tatgatttggttttaatggacattgttatgccaaacctagatggtgccacagcgacatcc
attgtcagaagttttgataatgagactcccatcattgccatgacaggtaacattatgaat
caagacttgatcacatacttacaacatggaatgaatgatatcttggccaaaccattcacg
agggatgatttacactcaattttaatacgttatctaaaggaccgtattcctttatgcgaa
cagcaattaccacctcgcaactcttcgccacaaactcattccaacaccaatactgctaat
tcgaatcctaatacgattaatgaacagtcgttagccatgttaccacaagataatccgtca
actactacccctgttaccccaggtgcctctatatcttctgcacagcatgttcaacaaggt
caacaagaacagcagcatcaaattttccatgctcagcagcagcagcagcatcacaacgcc
attgctaatgctaggtcagacgtagccataccgaatttggaacatgaaatcaacactgta
ccacattcctcaatgggttccactccgcaattaccacaatctacacttcaagaaaaccag
ctatcataa

DBGET integrated database retrieval system