KEGG   Saccharomyces cerevisiae (budding yeast): YHR207CHelp
Entry
YHR207C           CDS       T00005                                 

Gene name
SET5
Definition
(RefSeq) S-adenosylmethionine-dependent methyltransferase
  KO
K07117  uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    YHR207C (SET5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 856614
NCBI-ProteinID: NP_012077
SGD: S000001250
UniProt: P38890
Position
VIII:complement(514905..516485)
Genome map
AA seq 526 aa AA seqDB search
MTLTIKIGTLNDSDQSAVHNGTENGSDFRKITPTEEEICDDVVLLWKEEPGTEDATIQHL
YDRITERNQSWKLSASRFRKILNEHHLYDTDLETVSLYKDKIHFPKALDSDAKVEVKFID
DEHGRGLFAKRDFSKGQIILKENKPIVYIPPLDKLFLISNGKACARCGKALYDLTQHKIM
VHYLDCEVCKAIWCSEKCKKAHASLHELLYHSWRSNRIDILHAGNWKRFVNYCEKYCFTA
AFSVGLIYGSMLLDTTGEVKEQWQKLASISQRERIKLRDASGIGSTFSLLNGTTVHTEEE
SDNGTKKGVEKNIDDETVWEKCYELFCGAFPKASEEIDFEKFLTMIGTFNINQYNGQVYH
WISFINHDCEPNAYIEQVEEHEELRLHARKPIKKGEQIRITYVNPLHGVRLRRRELRVNW
GFLCQCDRCQNELSTFERVPNLEKKNADANLGVEKIDSNDSSEDGSKKSTGNRKSSMREA
QPDLKEILKNGKEFELDIPETVDTQGNVRKTSVRFDSNVSVAVDER
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacattgactatcaaaataggaaccttaaacgatagcgatcaatctgcagtgcataat
ggtacagaaaatggctctgattttcgaaagataactcccacagaggaagagatctgtgat
gacgtagttttgttatggaaggaagagcccggaactgaagacgctacgattcagcatctt
tatgacaggattacggaaagaaatcaatcgtggaaattgagtgcttctcgttttcgaaaa
attctaaatgagcaccatctttatgacacagatctagagaccgtttctctatataaagat
aaaatacattttccaaaagccctagattctgatgctaaggtcgaagtgaaatttattgat
gacgaacatggaaggggccttttcgctaaaagagatttttccaagggccaaatcatcctg
aaagaaaataaacctatcgtatatattccaccactggacaagctttttttaatatctaat
ggaaaggcatgtgctcgatgtggtaaggcgctatatgatttgacccagcacaaaattatg
gtccattatttggattgtgaagtttgcaaagctatttggtgcagtgaaaaatgtaaaaaa
gcacatgcgtcgttacatgagcttttataccactcatggagatcgaatagaatagacatt
cttcatgctggtaattggaaaagatttgttaactactgtgagaaatattgttttaccgct
gccttttcagttggtcttatatatggatccatgcttttggatactacaggagaggtcaaa
gagcaatggcaaaaattggcaagcatctcacaaagggaaagaattaaattaagagacgcc
agcggtatcggcagtacgtttagtttactgaatggtacaactgtacatactgaagaggaa
tctgataatggtaccaaaaagggcgttgagaagaatattgatgacgagactgtttgggag
aagtgctacgaattattttgcggtgcatttccaaaagcttctgaagaaatagatttcgag
aaatttttgaccatgatcgggacgttcaatatcaatcaatataacggccaggtatatcat
tggatctccttcataaaccatgattgtgaaccaaacgcctatattgagcaagtagaagaa
catgaggaactgaggttgcatgcaaggaaaccaataaagaagggggaacaaatacgtatt
acgtacgtcaatcccttacatggggtgaggttgaggcgtagggaattaagagttaactgg
ggcttcttatgccagtgtgaccgctgtcaaaatgaactatctacatttgaaagagttcca
aatctagagaaaaagaatgcggatgctaatttaggagtagaaaaaatagattccaatgat
agtagtgaagatggctctaagaaatcaactggtaatcgtaaatcttccatgagagaggcc
cagccagatttaaaagaaatactgaagaatggaaaagaatttgaattagacataccagaa
actgttgatacacaagggaatgtaagaaaaacctcagtcagattcgattcaaacgtttcg
gtcgcagtggatgaaagataa

DBGET integrated database retrieval system