KEGG   Saccharomyces cerevisiae (budding yeast): YHR208WHelp
Entry
YHR208W           CDS       T00005                                 

Gene name
BAT1, ECA39, TWT1
Definition
(RefSeq) branched-chain-amino-acid transaminase BAT1
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00270  Cysteine and methionine metabolism
sce00280  Valine, leucine and isoleucine degradation
sce00290  Valine, leucine and isoleucine biosynthesis
sce00770  Pantothenate and CoA biosynthesis
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01210  2-Oxocarboxylic acid metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sce_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    YHR208W (BAT1)
   00280 Valine, leucine and isoleucine degradation
    YHR208W (BAT1)
   00290 Valine, leucine and isoleucine biosynthesis
    YHR208W (BAT1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    YHR208W (BAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sce01007]
    YHR208W (BAT1)
Enzymes [BR:sce01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     YHR208W (BAT1)
Amino acid related enzymes [BR:sce01007]
 Aminotransferase (transaminase)
  Class IV
   YHR208W (BAT1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 856615
NCBI-ProteinID: NP_012078
SGD: S000001251
UniProt: P38891
Position
VIII:517532..518713
Genome map
AA seq 393 aa AA seqDB search
MLQRHSLKLGKFSIRTLATGAPLDASKLKITRNPNPSKPRPNEELVFGQTFTDHMLTIPW
SAKEGWGTPHIKPYGNLSLDPSACVFHYAFELFEGLKAYRTPQNTITMFRPDKNMARMNK
SAARICLPTFESEELIKLTGKLIEQDKHLVPQGNGYSLYIRPTMIGTSKGLGVGTPSEAL
LYVITSPVGPYYKTGFKAVRLEATDYATRAWPGGVGDKKLGANYAPCILPQLQAAKRGYQ
QNLWLFGPEKNITEVGTMNVFFVFLNKVTGKKELVTAPLDGTILEGVTRDSVLTLARDKL
DPQEWDINERYYTITEVATRAKQGELLEAFGSGTAAVVSPIKEIGWNNEDIHVPLLPGEQ
CGALTKQVAQWIADIQYGRVNYGNWSKTVADLN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagagacattccttgaagttggggaaattctccatcagaacactcgctactggt
gccccattagatgcatccaaactaaaaattactagaaacccaaatccatccaagccaaga
ccaaatgaagaattagtgttcggccagacattcaccgatcatatgttgaccattccttgg
tcagccaaagaagggtggggcactccacacatcaagccttacggtaatctttctcttgac
ccatctgcttgtgtattccattatgcatttgaattatttgaaggtttgaaagcctacaga
actcctcaaaatactatcaccatgttccgtccggataagaacatggcccgtatgaacaag
tctgccgctagaatttgtttgccaactttcgaatctgaagaattgatcaaacttaccggg
aaattgatcgaacaagataaacacttggttcctcaaggtaatggttactcattatacatc
agaccaacaatgattggtacatccaagggtttaggtgttggcactccctccgaggctctt
ctttatgttattacttctccagtcggtccttattataagactggtttcaaagccgtacgt
cttgaagcaacagactatgctacaagagcttggccaggtggtgttggcgacaaaaaattg
ggtgctaactatgccccatgcatcttacctcaactacaagctgccaaaagagggtaccaa
caaaatctatggttgttcggcccagaaaagaacatcactgaggttggtactatgaacgtg
ttcttcgttttcctcaacaaagtcactggcaagaaggaattggttaccgctccattagat
ggtaccattttagaaggtgttaccagagactctgttttaacattggctcgtgacaaacta
gatcctcaagaatgggacatcaacgagcgttattacactattactgaagtcgccactaga
gcaaaacaaggtgaactattagaagccttcggttctggtactgctgctgtcgtttcacct
atcaaggaaattggctggaacaacgaagatattcatgttccactattgcctggtgaacaa
tgtggtgcattgaccaagcaagttgctcaatggattgctgatatccaatacggtagagtc
aattatggtaactggtcaaaaactgttgccgacttgaactaa

DBGET integrated database retrieval system