KEGG   Saccharomyces cerevisiae (budding yeast): YHR216WHelp
Entry
YHR216W           CDS       T00005                                 

Gene name
IMD2, PUR5
Definition
(RefSeq) IMP dehydrogenase IMD2
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00230  Purine metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Module
sce_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    YHR216W (IMD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YHR216W (IMD2)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     YHR216W (IMD2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YHR216W (IMD2)
  Exosomal proteins of breast cancer cells
   YHR216W (IMD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IMPDH CBS FMN_dh NMO His_biosynth ThiG
Motif
Other DBs
NCBI-GeneID: 856626
NCBI-ProteinID: NP_012088
SGD: S000001259
UniProt: P38697
Position
VIII:554396..555967
Genome map
AA seq 523 aa AA seqDB search
MAAIRDYKTALDFTKSLPRPDGLSVQELMDSKIRGGLTYNDFLILPGLVDFASSEVSLQT
KLTRNITLNIPLVSSPMDTVTESEMATFMALLGGIGFIHHNCTPEDQADMVRRVKNYENG
FINNPIVISPTTTVGEAKSMKEKYGFAGFPVTTDGKRNAKLVGVITSRDIQFVEDNSLLV
QDVMTKNPVTGAQGITLSEGNEILKKIKKGRLLVVDEKGNLVSMLSRTDLMKNQNYPLAS
KSANTKQLLCGASIGTMDADKERLRLLVKAGLDVVILDSSQGNSIFELNMLKWVKESFPG
LEVIAGNVVTREQAANLIAAGADGLRIGMGTGSICITQEVMACGRPQGTAVYNVCEFANQ
FGVPCMADGGVQNIGHITKALALGSSTVMMGGMLAGTTESPGEYFYQDGKRLKAYRGMGS
IDAMQKTGTKGNASTSRYFSESDSVLVAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIG
CRSLTLLKNNVQRGKVRFEFRTASAQLEGGVHNLHSYEKRLHN
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccgccattagagactacaagaccgcactagactttaccaagagcctaccaagaccg
gatggtttgtcagtgcaggaattgatggactccaagatcagaggtgggttgacttataac
gattttttaatcttaccaggtttagtcgattttgcgtcctctgaagttagcctacagacc
aagctaaccaggaatattactttaaatattccattagtttcctctccaatggacacggtg
acagagtcagaaatggccacttttatggctctgttgggtggtatcggtttcattcaccat
aactgtaccccagaggaccaagctgacatggtcagaagagtcaagaactatgaaaatggg
tttattaacaaccctatagtgatttctccaactacgaccgttggtgaagctaagagcatg
aaggaaaagtatggatttgcaggcttccctgtcacgacagatggaaagagaaatgcaaag
ttggtgggtgtcatcacctctcgtgatatacaattcgttgaggacaactctttactcgtt
caggatgtcatgaccaaaaaccctgttaccggcgcacaaggtatcacattatcagaaggt
aacgaaattctaaagaaaatcaaaaagggtaggctattggttgttgatgaaaagggtaac
ttagtttctatgctttcccgaactgatttaatgaaaaatcagaactacccattagcgtcc
aaatctgccaacaccaagcaactgttatgtggtgcttctattgggactatggacgctgat
aaagaaagactaagattattggtaaaagctgggttggatgtcgtcatattggattcatcc
caaggaaactctatcttcgaattgaacatgctcaagtgggtcaaagagagtttcccaggt
ctggaagtcatcgctggtaacgttgtcaccagggaacaagctgccaatttgattgctgcc
ggtgcggacggtttgagaattggtatgggaactggctctatttgtattacccaagaagtt
atggcttgtggtaggccacaaggtacagccgtctacaatgtgtgtgaatttgctaaccaa
ttcggtgttccatgtatggctgatggtggtgttcaaaacattggtcatattaccaaagct
ttggctcttggttcttctactgttatgatgggtggtatgttggccggtactaccgaatca
ccaggtgaatatttctatcaagatggtaaaagattgaaggcgtatcgtggtatgggctcc
attgacgccatgcaaaagactggtaccaaaggtaatgcatctacctcccgttacttttcc
gaatcagacagtgttttggtcgcacaaggtgtctccggtgctgtcgttgacaaaggatcc
attaagaaatttattccatatttgtacaatggtttacaacattcctgtcaagacatcggc
tgtaggtcgctaactttattaaagaataatgttcaaaggggtaaagttagatttgaattc
agaaccgcttctgctcaactagaaggtggcgttcataatttacattcttacgaaaagcgt
ttacataactga

DBGET integrated database retrieval system