KEGG   Saccharomyces cerevisiae (budding yeast): YIL004CHelp
Entry
YIL004C           CDS       T00005                                 

Gene name
BET1, SLY12
Definition
(RefSeq) Bet1p
  KO
K08504  blocked early in transport 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    YIL004C (BET1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YIL004C (BET1)
Membrane trafficking [BR:sce04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    YIL004C (BET1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Use1 HTH_8 Pou POTRA_TamA_1
Motif
Other DBs
NCBI-GeneID: 854813
NCBI-ProteinID: NP_012262
SGD: S000001266
UniProt: P22804
Position
IX:complement(join(347946..348363,348495..348505))
Genome map
AA seq 142 aa AA seqDB search
MSSRFAGGNAYQRDTGRTQLFGPADGSNSLDDNVSSALGSTDKLDYSQSTLASLESQSEE
QMGAMGQRIKALKSLSLKMGDEIRGSNQTIDQLGDTFHNTSVKLKRTFGNMMEMARRSGI
SIKTWLIIFFMVGVLFFWVWIT
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaagatttgcagggggaaacgcttatcaacgtgatactggtagaacacagtta
ttcggaccggctgatggatcaaatagtctcgatgacaatgtatcatcagcgctagggagc
acagataaattagactactcccaaagtactttggcatctcttgaatctcaaagtgaggaa
cagatgggagctatgggtcagagaataaaagcactcaagtcattatcgttgaagatgggt
gatgagattagaggcagcaatcaaactattgaccagcttggtgatactttccataacact
tctgtaaaactcaaaaggacttttggaaacatgatggagatggccagaagatctgggatc
agtataaaaacatggttaataatattttttatggtaggcgtgctatttttttgggtatgg
attacataa

DBGET integrated database retrieval system