KEGG   Saccharomyces cerevisiae (budding yeast): YIL006W
Entry
YIL006W           CDS       T00005                                 

Gene name
YIA6, NDT1
Definition
(RefSeq) NAD+ transporter
  KO
K15115  solute carrier family 25 (mitochondrial folate transporter), member 32
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YIL006W (YIA6)
Transporters [BR:sce02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   YIL006W (YIA6)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 854811
NCBI-ProteinID: NP_012260
SGD: S000001268
UniProt: P40556
Position
IX:344062..345183
AA seq 373 aa
MTQTDNPVPNCGLLPEQQYCSADHEEPLLLHEEQLIFPDHSSQLSSADIIEPIKMNSSTE
SIIGTTLRKKWVPLSSTQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYR
GIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQS
CAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGL
VPSLLGLFHVAIHFPIYEDLKVRFHCYSRENNTNSINLQRLIMASSVSKMIASAVTYPHE
ILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEY
FRNRLENISTMVI
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgacacagactgataatcctgtccccaactgcggtttactgcccgagcagcagtattgc
tctgcagaccatgaagagccactgttgttgcatgaagaacaattgatattccctgatcat
tcctcccaactgtcctcagcagatatcatcgagcccatcaagatgaacagcagtactgag
tcaattatagggacaacgctgcgaaagaaatgggtaccactatcctcaactcagatcaca
gctctttccggcgcatttgctggattcttatcaggtgtggcagtatgtcccctcgatgtt
gccaaaacgcgattgcaagcacaaggactacaaactaggttcgagaacccctactatagg
gggataatggggacattaagtactatagtaagagacgaaggcccgcggggcctctacaaa
gggctggtaccgattgtcctgggctacttcccaacctggatgatatacttctccgtgtat
gaattcagcaaaaagttctttcacggcatcttcccacagtttgattttgttgctcagtca
tgtgctgcaatcacggcaggcgctgcatctaccaccttgaccaacccaatctgggttgtg
aagacaagacttatgctgcaatcaaacctcggtgagcaccccacacattacaaaggcact
ttcgatgcattcagaaagctattttatcaggaagggtttaaagcattatatgcggggctg
gtcccctcattattagggctatttcatgtggctatccatttccctatatacgaagatttg
aaggtaagatttcactgctattctcgggagaacaacaccaactccatcaacttgcaacgg
ttgatcatggcatcgtccgtctctaagatgattgcatcagcagtaacatatccgcacgaa
attttacgaaccagaatgcaactgaaatcagatataccagattccattcaacgacgtctg
ttccccctcattaaagcaacttatgcacaagagggactaaagggattttattctggattt
actactaacctagtacgaaccattccggcctcggcaatcactctagtgtcctttgagtat
ttcagaaaccgcctagaaaatattagcactatggtaatttaa

DBGET integrated database retrieval system