KEGG   Saccharomyces cerevisiae (budding yeast): YIL007CHelp
Entry
YIL007C           CDS       T00005                                 

Gene name
NAS2
Definition
(RefSeq) Nas2p
  KO
K06693  26S proteasome non-ATPase regulatory subunit 9
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sce03051]
    YIL007C (NAS2)
Proteasome [BR:sce03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     YIL007C (NAS2)
  Proteasome interacting proteins (PIPs)
   Other PIPs
    YIL007C (NAS2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nas2_N PDZ PDZ_6 PDZ_2 GRASP55_65
Motif
Other DBs
NCBI-GeneID: 854810
NCBI-ProteinID: NP_012259
SGD: S000001269
UniProt: P40555
Structure
PDB: 

Position
IX:complement(342994..343656)
Genome map
AA seq 220 aa AA seqDB search
MEEEELSKLLANVKIDPSLTSRISQIDSFKLSELMVLKTDIETQLEAYFSVLEQQGIGMD
SALVTPDGYPRSDVDVLQVTMIRKNVNMLKNDLNHLLQRSHVLLNQHFDNMNVKSNQDAR
RNNDDQAIQYTIPFAFISEVVPGSPSDKADIKVDDKLISIGNVHAANHSKLQNIQMVVMK
NEDRPLPVLLLREGQILKTSLTPSRNWNGRGLLGCRIQEL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaagaattaagtaaattgttggccaatgttaagatagatccgagcctaaca
tcaagaattagtcaaatagacagcttcaaactgtcggaattgatggttctaaagacagat
attgagacacaactagaggcgtatttcagtgtgcttgagcagcaaggcatcggcatggac
tctgcgttggtgacgccagacgggtatcctcgttcggatgtcgatgtattgcaagtcact
atgatcagaaagaatgttaatatgctgaagaatgatttaaatcaccttttgcaaagatca
cacgtcttactaaaccagcactttgataatatgaacgttaagtcaaaccaagatgcaaga
aggaataacgacgatcaagctattcagtataccatcccttttgcatttatcagtgaggta
gtacccggtagcccttcagataaagcagacataaaggttgatgataagctgatttctatt
ggtaatgtgcatgcggcaaaccactctaaacttcaaaacattcagatggttgtaatgaaa
aatgaagacaggccacttcccgtccttctcttgagagaagggcaaatcctaaagacatcg
ctaacaccttcgagaaactggaatggtagaggtcttttgggttgtaggatacaagagcta
taa

DBGET integrated database retrieval system