KEGG   Saccharomyces cerevisiae (budding yeast): YIL010WHelp
Entry
YIL010W           CDS       T00005                                 

Gene name
DOT5
Definition
(RefSeq) thioredoxin peroxidase DOT5
  KO
K03564  peroxiredoxin Q/BCP [EC:1.11.1.15]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YIL010W (DOT5)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     YIL010W (DOT5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin AhpC-TSA_2
Motif
Other DBs
NCBI-GeneID: 854805
NCBI-ProteinID: NP_012255
SGD: S000001272
UniProt: P40553
Structure
PDB: 

Position
IX:334882..335529
Genome map
AA seq 215 aa AA seqDB search
MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDV
NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE
LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF
VDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagcactacgtagatcaaccaggattgcaatatccaaaagaatgttggaagag
gaagagtccaaactggcccctatttcgacaccggaagtgcctaagaagaaaatcaagacg
ggtcctaaacataacgctaatcaagcagtagttcaagaggcaaataggtcatctgatgtt
aacgaattagagataggcgatcctattcctgatttgagtcttttaaatgaagataatgac
tctatctccttgaagaaaatcaccgaaaataacagagttgtggtgttttttgtgtatccc
agggcaagcacgcctggttgtactagacaggcctgtggatttcgtgacaattaccaggaa
ctcaagaaatatgctgctgtctttggactgagtgcagattctgtgacatcccagaaaaag
tttcagagtaaacaaaatttgccatatcatttactaagcgatccaaagagagagtttatt
gggttgctaggagccaaaaaaacgccactttctggttctattagatcgcatttcattttt
gttgatgggaagttaaaattcaaaagagttaagatatcaccagaagttagtgtaaatgac
gccaaaaaggaggttttagaagtcgctgaaaagtttaaagaagaatga

DBGET integrated database retrieval system