KEGG   Saccharomyces cerevisiae (budding yeast): YIL013CHelp
Entry
YIL013C           CDS       T00005                                 

Gene name
PDR11
Definition
(RefSeq) ATP-binding cassette multidrug transporter PDR11
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane ABC_tran PDR_CDR ABC2_membrane_3 RsgA_GTPase AAA_21 SMC_N AAA_16 AAA_23 AAA_22 AAA_18 AAA_29 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 854802
NCBI-ProteinID: NP_012252
SGD: S000001275
UniProt: P40550
Position
IX:complement(328207..332442)
Genome map
AA seq 1411 aa AA seqDB search
MSLSKYFNPIPDASVTFDGATVQLEESLGAVQNDEESASEFKNVGHLEISDITFRANEGE
VVLVLGNPTSALFKGLFHGHKHLKYSPEGSIRFKDNEYKQFASKCPHQIIYNNEQDIHFP
YLTVEQTIDFALSCKFHIPKQERIEMRDELLKEFGLSHVKKTYVGNDYVRGVSGGERKRI
SIIETFIANGSVYLWDNSTKGLDSATALEFLSITQKMAKATRSVNFVKISQASDKIVSKF
DKILMLGDSFQVFYGTMEECLTHFHDTLQIKKNPNDCIIEYLTSILNFKFKETSNSIVGL
DTPSVVSEENQALNINNETDLHTLWIQSPYYKHWKAITSKTVQECTRKDVNPDDISPIFS
IPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIPLTTIGSFSRGSLT
FFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLATNFFDCCSKFILVVIFTI
ILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTALIAPTLSMANLLAGILLLAIAMY
ASYVIYMKDMHPWFIWIAYLNPAMFAMEAILSNELFNLKLDCHESIIPRGEYYDNISFSH
KACAWQGATLGNDYVRGRDYLKSGLKYTYHHVWRNFGIIIGFLCFFLFCSLLAAEYITPL
FTRENLLRWNNYLKRYCPFLNSQKKNNKSAITNNDGVCTPKTPIANFSTSSSSVPSVSHQ
YDTDYNIKHPDETVNNHTKESVAMETQKHVISWKNINYTIGDKKLINDASGYISSGLTAL
MGESGAGKTTLLNVLSQRTESGVVTGELLIDGQPLTNIDAFRRSIGFVQQQDVHLELLTV
RESLEISCVLRGDGDRDYLGVVSNLLRLPSEKLVADLSPTQRKLLSIGVELVTKPSLLLF
LDEPTSGLDAEAALTIVQFLKKLSMQGQAILCTIHQPSKSVISYFDNIYLLKRGGECVYF
GSLPNACDYFVAHDRRLTFDREMDNPADFVIDVVGSGSTNIPMDDAEKPTSSKIDEPVSY
HKQSDSINWAELWQSSPEKVRVADDLLLLEEEARKSGVDFTTSVWSPPSYMEQIKLITKR
QYICTKRDMTYVFAKYALNAGAGLFIGFSFWRTKHNINGLQDAIFLCFMMLCVSSPLINQ
VQDKALQSKEVYIAREARSNTYHWTVLLIAQTIVELPLAISSSTLFFLCCYFCCGFETSA
RVAGVFYLNYILFSMYYLSFGLWLLYSAPDLQTAAVFVAFLYSFTASFCGVMQPYSLFPR
FWTFMYRVSPYTYFIETFVSLLLHDREVNCSTSEMVPSQPVMGQTCGQFMKPFIDEFGGK
LHINNTYTVCAYCMYTVGDDFLAQENMSYHHRWRNFGFEWVFVCFNIAAMFVGFYLTYIK
KIWPSVIDGIKKCIPSMRRSKTSHNPNEQSV
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttccaaatattttaatccaattcctgacgcttcagtcacctttgatggggct
accgttcaattggaagaatccctcggtgctgttcagaacgatgaagagtccgcatcggaa
ttcaaaaacgtaggccatttagaaattagtgatatcacttttcgtgctaatgaaggtgaa
gtcgtcttagtactgggaaacccaacatcagcgctcttcaaaggtctattccatggtcac
aagcatctgaaatactcgcctgaagggtctattagattcaaagacaatgagtacaaacag
tttgcttccaaatgcccccatcagatcatttataataacgaacaagatattcacttcccg
tatctgacggtggagcaaaccattgattttgcgttgagttgtaagtttcacattcccaag
caagagcgtattgaaatgagagacgagttattaaaagagttcggactgtcgcacgtaaag
aagacgtatgtgggtaatgactacgttcgtggtgtttctggaggtgaaaggaaacgtatc
tccattatagaaacgtttattgccaatgggtctgtttacttatgggacaactcgacgaag
ggtttggactctgccaccgccctagaatttctttccattacccaaaagatggcaaaagct
acaagatcggtgaattttgttaaaatttctcaagcaagcgacaaaattgtcagcaagttt
gacaagattcttatgttaggtgattccttccaggtgttttacggaaccatggaggagtgt
ttaacccattttcatgacaccttacagataaaaaaaaaccctaacgattgtattattgaa
tatttaacatcaatcttaaattttaagttcaaggaaacgtctaattccattgttggtctt
gacactccatctgttgtttctgaagaaaatcaagctttaaacatcaataatgaaacagat
ttgcatacattatggattcagtctccatactataaacactggaaggccatcacttcaaaa
acagtgcaagaatgcaccagaaaagatgttaatccggatgatatctcccccatttttagt
attccgctaaagacgcaactgaaaacgtgcactgtaagagctttcgaaagaatcattggt
gacagaaactacttgatttctcaatttgtttctgttgtggtgcagtctttggttattggg
tcccttttttataacattcccctgacaacaattggttcgttttctagaggatctttaact
ttcttttccatcctattctttacatttctttctctcgccgacatgcctgcttcctttcaa
aggcaacccgtcgttcgtaaacatgtccagctccatttttattataattgggtggaaact
ttagcaacaaattttttcgattgctgctctaaatttatactggtggttatttttacaatc
atactttactttttggcccatttacagtacaatgcagctaggtttttcatctttttgctt
ttcctttccgtctataatttttgcatggtgtcactatttgcattaactgctttgatcgct
ccaactctatcaatggcaaacctattggccggtatcttactgttagccattgccatgtac
gcgtcctatgttatttatatgaaagatatgcatccatggttcatatggattgcatatttg
aatcctgctatgtttgccatggaagccattttgagtaacgaattgtttaacctgaaacta
gactgtcatgaaagtattattcccagaggtgaatattatgacaatatttcattcagtcat
aaagcttgtgcctggcaaggcgctaccctaggtaacgattacgtcagaggccgtgattat
ttaaaaagtggattgaaatacacttaccatcacgtgtggagaaatttcggtattatcatt
gggtttctgtgtttcttcctattttgctctttactagcagcggaatatatcacgcctctg
tttactagagaaaatttattgcgctggaataactatctcaaaagatactgtccctttctg
aatagccaaaaaaagaataataaaagcgctattaccaacaacgatggcgtatgtactccc
aagaccccgatagccaatttttccacttcatcctcttctgttccatcagtctcgcatcaa
tacgatactgattacaatattaaacatccagatgaaactgttaacaatcatactaaggaa
tccgtagctatggaaacgcaaaagcacgtcatctcctggaaaaatatcaattataccatt
ggagacaaaaaattgatcaacgacgcttctggatatataagttccggattaactgcccta
atgggtgaatctggtgctggtaagacaactttgttgaatgtcttgtctcaaaggaccgaa
agcggggttgttaccggtgaattattaatcgatggacagcccttaacgaatattgatgca
ttcagaagaagtatagggttcgttcaacagcaagatgttcatttagagctcttaactgtg
agagagtctttggaaatttcctgcgtcctaagaggtgatggggatagagactatttagga
gttgttagcaacctattaagattgccttcggaaaaactggttgctgatttatctccaact
caaagaaaattattatctattggtgttgaattggtcactaagccttctctgttgttattc
ctagatgaacctacttcagggctagacgccgaagcagctttaaccatcgtgcaatttctg
aaaaagctttcgatgcaaggtcaggctatcttatgtactattcatcagcctagcaaaagt
gtcatcagctattttgataacatctatttactaaaaagaggtggtgagtgtgtctatttt
ggttcattacctaatgcctgtgactattttgtagctcacgatagacgcctaacatttgac
agagaaatggataatccggctgatttcgttattgacgttgttggtagcggaagtacaaat
attccaatggatgatgcagagaagccaacctcaagcaaaattgatgagccagtatcttac
cataagcaatctgattcaattaactgggcagaactctggcaatcctctccagaaaaagtg
cgggttgctgatgatttgcttttattagaagaagaagcccggaaatctggtgttgatttc
actacgtccgtatggagtccgccttcgtatatggaacaaataaagttaatcacaaagaga
cagtacatttgtaccaagagagacatgacctatgttttcgctaaatatgctttgaatgct
ggcgctggactattcattggattttcattttggaggacaaagcataatatcaacggtctg
caagatgctattttcttgtgcttcatgatgctttgtgtttcctcccctttgatcaatcag
gttcaagataaggctttgcaatctaaagaagtatatatcgccagggaagcgagatctaat
acttatcattggaccgttcttttgattgctcaaactattgttgaattaccattagccatt
tccagttctaccttatttttcctgtgttgctacttctgttgcggtttcgaaacctctgcc
cgtgtagctggtgtcttttacttgaattatattttattttccatgtattatttgtcattt
gggttgtggcttctatattctgcccccgatttacaaactgccgctgtctttgttgccttc
ctctatagtttcacagcttcattctgtggcgttatgcaaccatactcgttattcccaaga
ttttggacattcatgtacagggtttcaccatacacgtatttcattgaaactttcgtaagc
ttacttctccatgacagagaagtaaactgctcgacaagtgaaatggtaccaagccaacct
gtaatgggtcaaacctgcggtcagtttatgaaaccctttattgatgaatttggtgggaaa
ctgcacatcaataacacatacaccgtctgcgcctactgcatgtacactgttggggatgac
ttccttgctcaagaaaatatgagttatcatcacagatggagaaattttggttttgaatgg
gttttcgtttgctttaacattgccgccatgtttgtgggcttctacctaacctacatcaaa
aaaatttggccttctgtgattgatggtataaagaagtgtatcccatcaatgaggcggtcc
aaaacatctcataatccaaacgaacaaagcgtataa

DBGET integrated database retrieval system