KEGG   Saccharomyces cerevisiae (budding yeast): YIL014WHelp
Entry
YIL014W           CDS       T00005                                 

Gene name
MNT3
Definition
(RefSeq) alpha-1,3-mannosyltransferase MNT3
  KO
K10969  alpha 1,3-mannosyltransferase [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    YIL014W (MNT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YIL014W (MNT3)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     YIL014W (MNT3)
Glycosyltransferases [BR:sce01003]
 Glycan extension
  Yeast mannan chain
   YIL014W (MNT3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannosyl_trans3
Motif
Other DBs
NCBI-GeneID: 854801
NCBI-ProteinID: NP_012251
SGD: S000001276
UniProt: P40549
Position
IX:326103..327995
Genome map
AA seq 630 aa AA seqDB search
MLKSLKSRRLILKRLVTLLLSLFFSYLIFSASRNVTSSNKLNNHASERTAVESSAFNWIE
KRQHQVRSENLMNRLSAYFLPFLSRSSHKERVLLRQLGNNEIAKSDKCRYIFEVLYKIDP
DWDNAQTAKFYNVDGVDNTLASLLGERLRSYDYCFLSGQLDPTAIFANSTVNPHDLQNRM
FPFLKKINEESKTVMWPIITDMTTGEAVPAPEVDMESSNFNGNFWSNWNRLSKGRGFVLT
IAEKDVPLFLKQLKVMEFSKNELPFQIVSTGNELSAESIAKISETAKETEQRVYLVDCST
VLDTNFANTYISFFQNKWVATLFNTFEEYILLDADVVPFVGSDYFFDSPSYRESGILLFK
DRVMENEQTFQYCIEMLNEVEPSAQERRFIGSRLVFDSSLPFSSETSEEASVYYNFFKKL
RLHHVDSGLVVVNKLEKLNGLLMSFMLNLDGKLQRCVYGDKEIFWLGQLYAGQDYSINPV
DGSIIGPVNEEPENDDGHKSGMYYICSTQIAHSDSKNRLLWVNGGLKTCKISNSAEDDFG
REPEYFKSRYGDISKLKRIYDASLNVEGLIVPDVSVHPWMQIKECSNYMYCAYATGDGHT
NSELDEGRLITFTEKELRYINDISRTWNAN
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaatcattaaaatccagaagactaatcttaaaacgattagtaacactgctgctc
tctttattcttttcttatctcattttctctgccagtcggaatgttacatcatccaataaa
ttaaacaaccatgcaagcgagaggacagctgttgaatcatctgcattcaattggattgaa
aaacgacaacaccaagtgagatccgaaaacttaatgaacagattatctgcctactttttg
ccctttttgagtagaagttctcacaaagaacgtgtattgttgaggcaattaggaaataat
gaaatagcgaagagtgacaagtgccgttacatttttgaagtactatacaagattgatccc
gactgggacaatgcgcaaactgcaaaattttataatgttgatggtgtagataacacgttg
gcctcattgttaggggaaagattaagatcttatgattattgctttttatctggtcaatta
gatcctactgcaatatttgcaaattcaaccgtaaatcctcatgatttgcaaaacagaatg
tttccatttctgaagaaaattaacgaggaatccaaaactgtaatgtggcctattatcaca
gacatgacaactggagaggcagttccggcacccgaggttgatatggaatcatcaaacttt
aatggtaacttttggtccaactggaataggttgagcaaaggaagaggttttgttttaact
attgctgaaaaggatgttcctttatttttgaaacagttgaaagtgatggaattttcaaaa
aacgaattaccattccaaatagtatccacgggaaatgaactatcagcagagtctattgct
aaaatttctgagaccgctaaagaaacggaacaaagggtctacttagtagactgctcgaca
gtgcttgacactaattttgctaatacatacatttctttttttcagaataaatgggtcgcc
actttgttcaacacatttgaagaatacattttgttggatgcagacgtagtaccgtttgta
gggtctgattactttttcgactctccttcttacagggagagcgggatacttttgttcaag
gatagggttatggaaaacgagcaaactttccaatactgcatcgaaatgttaaatgaagtg
gaaccctctgcacaagaacgcagatttattggaagtaggttagtttttgattcgtcatta
ccgttttcttccgaaacctcagaagaagcatctgtgtattacaattttttcaaaaaatta
cgactccatcatgttgatagtggtttggttgtagtcaataaacttgagaaattaaatgga
ttgttgatgtcttttatgttaaatttggatggaaaattgcagaggtgtgtgtatggtgac
aaggaaatattctggttggggcaattatatgctggccaggattattctatcaatcccgtt
gatggcagtattattggacctgttaatgaagagcctgaaaatgatgacggacataaaagc
gggatgtactacatttgttctacgcagattgcacacagtgactccaaaaatcgattacta
tgggtaaacggtggactgaagacttgtaaaatttcgaacagtgctgaagatgactttgga
agagagccagagtattttaagagtagatatggggacatttcaaaattaaaaaggatatat
gatgcttcgttgaacgtagagggactaatcgttcctgacgtttctgttcatccatggatg
caaatcaaggaatgttctaattatatgtattgtgcatatgctacgggtgacggacacaca
aactctgaacttgacgaaggtcgtctaatcacgtttactgaaaaggaattacgatatatc
aatgatatttctcgaacctggaatgctaattga

DBGET integrated database retrieval system