KEGG   Saccharomyces cerevisiae (budding yeast): YIL055C
Entry
YIL055C           CDS       T00005                                 

Definition
(RefSeq) uncharacterized protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Other DBs
NCBI-GeneID: 854756
NCBI-ProteinID: NP_012209
SGD: S000001317
UniProt: P40523
Position
IX:complement(252042..253925)
AA seq 627 aa
MTLEPHYSAKSAASASAFVARSATESSTASTKAAPRKKTYSQSNGIPIRIDNLPPGKTWA
QVKYLIGGIIYHTNILQVKMLPPMTSMVPPFITFQSCIVILKNSIDNESLENLLLTLNTY
QWDYHDLFVYLLPYTNDSPSLRYPEISDSNNDVRSAPDETKRSISPRYASHVSSVTPQPP
SASTPPSQFFSFSPEVSLRKNENITPLPTPVPVPVGVPPLAPPPHGPFSTSMLPMLGAPP
GTVPNMQMPYQTTLPSPTAAATAGGPLASPTHYPRRRHFYHQNQSQFQKYMHNSPRNPDT
GTGPRLSQQHHLSLRNNKINPSYNEISALYNLNMASNSNNNGNIPTTSTNGDDRALQAKN
GGTITPSQTQINHKRLKHIFNEKSFRKQMTNRGMWQLKIINFPPYIPIEFLEKLSESDFN
ELMNQEKFTVIEIKEKGQLEKFGRLRWTVLKDFIKLKCPKLLRLQERQFLQQQNEASLLN
ESMDALKISENENTNGSANNSTYTNGGPRTSINNTREFYVGVYEDHEEATLLRFELPEDE
LEEFNRNLPTTFAQSGNVSDSEGDSKAKYFKVSTIVYNAIVGFHDKELSDLTFESLQDQE
YSLGYKIHVMELPPFDEDEFENQRQQF
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgactctagaaccacactatagtgccaagtcggctgcttcagccagtgcctttgttgcc
cgttctgcgaccgaaagctcaacagcaagcacaaaagctgctcctaggaaaaagacgtac
tcgcagtcaaatggtattcccataaggattgataatctccctccgggcaagacttgggcc
caggtaaaatatttgataggcggaatcatataccataccaatattttacaggtgaaaatg
ctgcctccaatgacttccatggttcctccttttattacttttcagagttgcattgtcatt
ctgaagaactcgatagataacgagtccctggaaaacttactacttactttgaacacctac
caatgggattatcatgatctgttcgtttacctgttgccgtacactaatgattctccttca
ctgcgatatccagaaatcagtgatagcaacaatgacgtccggagtgctcccgatgaaact
aaaagatctatttctcctcgatatgcaagccatgtttcatctgtgacaccgcagccacca
tccgcttctaccccaccttctcaatttttcagtttttctcctgaagtgagccttcgaaag
aatgagaacataacgccattgcccacgcctgttcccgtacctgttggtgtgccacctctt
gctcccccgcctcatggtccattttcgacttcgatgctacctatgttgggtgctcctccg
ggaacggtacctaatatgcagatgccctatcaaactactctaccttcaccaacagctgct
gctactgctggtggtccacttgcttcccctacacactatccccgtcgtcggcatttctat
caccagaaccaaagccagtttcaaaaatacatgcataatagccccaggaatccagatact
ggcacaggccctcgtctttctcagcagcatcacctctccttaaggaacaataagataaat
ccctcttataacgaaatatctgccctttacaacttgaacatggcctcaaattccaataat
aatggtaatattcccactacaagtacgaatggtgatgaccgtgccctccaagcaaagaat
ggtggaacaattacaccttcacaaactcaaataaatcacaaaagattaaagcatatcttt
aacgagaaaagctttagaaaacaaatgacgaatagaggtatgtggcagctgaagatcata
aatttcccaccctatatacctatagaattcttggagaaattatcagagtctgatttcaat
gagttaatgaaccaagagaagttcacagttattgaaattaaagagaaaggacaattggaa
aaatttggaaggctaagatggacagttctaaaagattttataaaactgaaatgccccaag
ctattaagactacaggaaagacagtttctacagcaacaaaacgaagcatctttactcaat
gaatctatggacgctctaaagatatcagaaaatgagaacaccaacgggagtgcaaataat
agcacatacacaaatggcggacctcgaacatctatcaataatacaagggaattctatgta
ggggtttatgaagatcatgaagaagcaactctactgaggtttgaattaccggaagatgaa
ttagaggagtttaatagaaatttgccaactacttttgcacaaagtggaaacgtctctgac
tccgaaggtgatagcaaggcgaaatactttaaagttagcacaattgtgtataatgccatt
gttgggttccacgataaagagctgtctgatttgacgttcgaatccttacaagaccaggaa
tattcactggggtacaaaattcatgtaatggaactgccaccatttgacgaggatgaattt
gaaaatcaacggcagcagttctaa

DBGET integrated database retrieval system