KEGG   Saccharomyces cerevisiae (budding yeast): YIL072W
Entry
YIL072W           CDS       T00005                                 

Gene name
HOP1
Definition
(RefSeq) Hop1p
  KO
K12778  meiosis-specific protein HOP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04113 Meiosis - yeast
    YIL072W (HOP1)
SSDB
Motif
Pfam: HORMA PHD_2
Other DBs
NCBI-GeneID: 854738
NCBI-ProteinID: NP_012193
SGD: S000001334
UniProt: P20050
Position
IX:226602..228419
AA seq 605 aa
MSNKQLVKPKTETKTEITTEQSQKLLQTMLTMSFGCLAFLRGLFPDDIFVDQRFVPEKVE
KNYNKQNTSQNNSIKIKTLIRGKSAQADLLLDWLEKGVFKSIRLKCLKALSLGIFLEDPT
DLLENYIFSFDYDEENNVNINVNLSGNKKGSKNADPENETISLLDSRRMVQQLMRRFIII
TQSLEPLPQKKFLTMRLMFNDNVDEDYQPELFKDATFDKRATLKVPTNLDNDAIDVGTLN
TKHHKVALSVLSAATSSMEKAGNTNFIRVDPFDLILQQQEENKLEESVPTKPQNFVTSQT
TNVLGNLLNSSQASIQPTQFVSNNPVTGICSCECGLEVPKAATVLKTCKSCRKTLHGICY
GNFLHSSIEKCFTCIFGPSLDTKWSKFQDLMMIRKVFRFLVRKKKGFPASITELIDSFIN
VEDQNNEVKERVAFALFVFFLDETLCLDNGGKPSQTIRYVTSSVLVDVKGIVIPNTRKQL
NVNHEYKWHFTTSSPKAESFYQEVLPNSRKQVESWLQDITNLRKVYSEALSPSSTLQELD
LNSSLPTQDPIISGQKRRRYDLDEYLEEDKSSVVNDTIKAKDFDESVPAKIRKISVSKKT
LKSNW
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgtctaataaacaactagtaaagccaaaaacagagacaaagacagaaataactactgaa
cagtctcaaaaactgctccaaacaatgctcacaatgtcttttggttgtttagcctttctc
agggggttgttccctgatgatatatttgttgaccaacggtttgtaccggagaaagttgaa
aaaaactacaataagcaaaacacgtctcaaaataactctatcaaaatcaagacattaatt
aggggcaaatcggctcaagcagatttattactggattggttggagaagggagttttcaaa
tccattcgtttaaagtgtttaaaagccctatcattaggtatatttctagaggatcccacc
gatctcctagaaaattacatttttagttttgattatgacgaagagaataatgtcaatatt
aatgtaaacttgagtggcaataaaaaagggagcaaaaatgccgacccagagaacgagaca
atttctttactagattcgagaaggatggttcaacagttaatgagacgatttatcataatt
acccaatccctggaacctttaccccaaaaaaagttcctcactatgaggttgatgtttaat
gataacgtcgatgaagattatcagccggagttgttcaaagacgcgacttttgacaaaaga
gcaactttaaaggtccccacaaatttagacaacgatgctattgacgtcggtactctgaac
acgaagcatcataaagttgctctttctgttttgtcggcggcaacatccagtatggaaaaa
gctgggaacacgaactttattagagtagacccctttgatttaattttgcaacaacaagaa
gaaaataaacttgaagaatctgttcctacaaaaccccagaattttgtcacaagccaaaca
accaatgtgcttggaaatcttttaaattcttcgcaagcaagtatacaaccaactcaattt
gtttcaaataacccagtcacgggcatttgtagttgcgaatgtggattggaagttcccaaa
gcagccaccgtgttaaagacttgtaaaagttgccgtaaaacactacacggcatctgttat
ggcaattttctacattcgtcaattgagaaatgctttacttgcatttttggaccttccttg
gatactaaatggtctaaatttcaggatcttatgatgattagaaaggtttttaggttcttg
gtgagaaaaaagaagggatttccggcctctataacagaactcattgatagttttatcaac
gtcgaagatcagaataacgaagtaaaagagagagttgcattcgccttatttgtatttttc
ttagatgaaacactatgcctcgataatgggggaaaacctagccaaactattaggtacgtt
acgagctctgtactcgttgatgtaaagggaattgtcataccaaatactagaaagcaactg
aacgtaaatcacgaatataaatggcactttaccaccagttcccctaaagccgagagcttc
tatcaagaggttctgcctaactcaagaaaacaagtcgagtcgtggttacaggatatcact
aacttaagaaaagtctattctgaagctctttctccgtcgtcaaccctacaggagcttgat
cttaactcaagcttgcctacgcaagatccaataatttctggccaaaaaaggagacgttac
gatcttgatgagtacttagaggaagataaaagctcagttgttaatgatacgataaaagca
aaagattttgatgaaagtgtaccagcaaagattcgcaaaatcagcgtctctaaaaagact
ttgaaaagtaactggtag

DBGET integrated database retrieval system