KEGG   Saccharomyces cerevisiae (budding yeast): YIL085CHelp
Entry
YIL085C           CDS       T00005                                 

Gene name
KTR7
Definition
(RefSeq) putative mannosyltransferase
  KO
K03854  mannosyltransferase [EC:2.4.1.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sce01003]
    YIL085C (KTR7)
Enzymes [BR:sce01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     YIL085C (KTR7)
Glycosyltransferases [BR:sce01003]
 Glycan extension
  Yeast mannan chain
   YIL085C (KTR7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 854724
NCBI-ProteinID: NP_012181
SGD: S000001347
UniProt: P40504
Position
IX:complement(200490..202043)
Genome map
AA seq 517 aa AA seqDB search
MAIRLNPKVRRFLLDKCRQKRYGFLFLGCIFAILYCMGTWPFFAKDIVHDPNNLPYSLQD
YSTDKDEPFFRGCTDTKLYLQNPAYSKMNASFVMLTRNEEIEDVLKTMRSIEGHFNKWFK
YPYVFLNDDPFTDHFKDQIQAATNATVEFGTVDEIMWEFPAKVRNSLQFKASLEDQNDRG
IMYGNMESYHKMCRFYSGIFYKHPLVSKYEWYWRIEPDVDFFCDISYDPFFEMAKHNKKY
GFTVLITELYWTVPNLFRTTKSFIKKTAGLKENLGTLWKLFTFNYNILDTDDEEISRWVN
FPWDAKPKLTEKLMVDFLLENHGQVNNEEDLEGIQYLVERARSKVPMLEDSLEGEDYNLC
HFWSNFEIARVDLFDNEIYNAYFKFLEESGGFWTERWGDAPIHSIGLGMTLDLEDVHYFR
DIGYRHSSLQHCPKNALQSQENLNTFDEGYNFGCGCRCVCPKKGEDIEDHSTPCMDIFFE
LLHGREYEKEFPGCYKPSIKDKDVIEEIRRENFRVIE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctataagattgaatccaaaagtcagaaggttcttgctggataagtgtcgacaaaaa
cgatatggtttcctctttttaggatgtatcttcgccatactttactgtatggggacctgg
ccatttttcgcaaaagatattgtacatgatccaaataatttgccttattccttacaggat
tattcgactgacaaagacgagccatttttccggggctgcactgatacaaagctgtacttg
caaaatcctgcttactccaaaatgaacgcatctttcgttatgctaacgagaaacgaagaa
atagaagacgtactgaaaactatgagaagtatagagggccatttcaataagtggttcaaa
tatccgtacgttttcttgaatgatgacccctttacagatcattttaaggaccaaattcaa
gctgcaactaatgccactgtagagtttggcactgttgatgaaattatgtgggagtttcct
gctaaggttcgtaattcattgcagtttaaggcttcattagaagaccaaaacgatcgcggt
ataatgtatggtaatatggaatcatatcacaagatgtgtcgattttactccgggatcttt
tataaacatccattagtttccaagtatgaatggtattggagaatagaacctgatgtggac
tttttttgtgacatctcgtatgatccctttttcgagatggccaaacataacaagaaatat
gggtttaccgtacttataactgaactgtactggactgtccccaacttgttcagaacaacc
aaaagctttataaaaaaaacggcaggtttaaaggaaaatctcggcacgttgtggaaatta
tttacatttaattataatattctagatacagatgatgaagaaatttctaggtgggtcaat
tttccctgggatgcaaagccaaagttgacagaaaagttgatggtagactttttgctagag
aatcatggtcaagtcaataatgaggaagatttggaaggtatacaatatctcgttgaaagg
gcccgctctaaggtgccaatgctagaggattcccttgaaggggaagattacaatttgtgt
catttttggagtaactttgaaattgcccgcgttgatttattcgacaatgagatctataac
gcctattttaaatttttggaagagtctggaggtttctggactgaaaggtggggtgacgcg
ccaattcattcaattgggttgggaatgaccttggatctagaagacgttcattatttcaga
gacattggttatagacactcatcgctgcagcattgtccgaagaatgccttacaaagccaa
gaaaatctcaacactttcgatgaaggttataacttcggatgtggatgtcgatgcgtgtgc
cccaagaaaggtgaagacatcgaagaccactccaccccttgcatggatattttttttgaa
ttgcttcacggcagggaatatgagaaggaattccctggttgttacaagccctccataaag
gacaaagacgtgattgaagagatcagaagagaaaattttagagtaattgaatag

DBGET integrated database retrieval system