KEGG   Saccharomyces cerevisiae (budding yeast): YIL088CHelp
Entry
YIL088C           CDS       T00005                                 

Gene name
AVT7
Definition
(RefSeq) Avt7p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aa_trans Reoviridae_Vp9
Motif
Other DBs
NCBI-GeneID: 854721
NCBI-ProteinID: NP_012178
SGD: S000001350
UniProt: P40501
Position
IX:complement(197931..199403)
Genome map
AA seq 490 aa AA seqDB search
MEATSSALSSTANLVKTIVGAGTLAIPYSFKSDGVLVGVILTLLAAVTSGLGLFVLSKCS
KTLINPRNSSFFTLCMLTYPTLAPIFDLAMIVQCFGVGLSYLVLIGDLFPGLFGGERNYW
IIASAVIIIPLCLVKKLDQLKYSSILGLFALAYISILVFSHFVFELGKGELTNILRNDIC
WWKIHDFKGLLSTFSIIIFAFTGSMNLFPMINELKDNSMENITFVINNSISLSTALFLIV
GLSGYLTFGNETLGNLMLNYDPNSIWIVIGKFCLGSMLILSFPLLFHPLRIAVNNVIIWI
EITYGGANPEEDPQVSEYTRASNLRPISMTVEDPAQPSDALDATSYNEQECLLPNGNFDN
GSIESQENNNDERGTMAVAGDNEHHAPFVKSRFYWITALLLISMYTLALSVQSFALVLSF
VGATGSTSISFTLPGLLGYKLIGLDSLAIGKMIPPKDRFYKRCSLLLVFYGLSVMFLSLY
VTVFNRSDEA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaggctacatcaagtgctctttcgtctacggcgaatctcgttaagacaatagttggc
gctggtacacttgccattccgtacagttttaaaagcgatggtgttctggtaggggttatt
cttacattattggcggcggtaacatccggtctgggtctctttgtgctatcgaaatgttcc
aagaccttaattaatccaagaaactcttctttcttcacattatgcatgctcacctatccc
actttggccccaatttttgatttggcaatgatagttcaatgctttggtgtgggcttaagt
tacttagttcttattggtgatctctttccaggactgtttggtggtgaaagaaattattgg
ataattgcatcagctgtaatcatcattcccctatgtttagtgaagaaactagatcaattg
aagtattctagtattctaggtcttttcgcgctagcatacatatcaattctggtgttcagt
cattttgtgtttgagctgggaaagggtgaattaacaaatatattaagaaatgacatatgc
tggtggaaaattcacgactttaaaggattattatcaacttttagcattataatttttgct
tttacgggatcaatgaacctattccccatgataaatgaattaaaagacaacagcatggaa
aatatcactttcgttatcaataattcgatatccttatcaacagcactatttttgatcgtt
ggtttatcaggatatttaaccttcggtaatgaaaccttgggtaatttaatgttgaactac
gatcctaactcaatttggatagtaattggcaaattctgtcttggctcaatgttaattctt
tccttcccgcttctctttcatccgctgcgcatagcagttaacaatgtcatcatctggatt
gagatcacttatggtggggcaaatcccgaagaggacccacaagtttcggaatacactcgt
gcttccaacctaagaccaattagcatgactgtggaagatccagcccagcccagtgatgca
ctagacgcaacttcttataacgagcaagaatgtttactacctaacgggaactttgataat
ggttcaattgaaagtcaagagaacaataatgatgaaagagggactatggcggtcgccggg
gataacgagcatcatgcgccatttgttaagtctagattttactggattactgcattatta
ctaataagcatgtataccttggcgttgtctgtccagtcatttgcactggttctttcattt
gtaggggctacaggttcaacgtctatttcattcactttacctggattattaggttacaaa
ttaataggcttggattctttggctattgggaagatgattccaccaaaagatagattttac
aaaaggtgcagcttattgctagtcttctacggactatctgtgatgtttttgtcattgtat
gtaactgtattcaaccgttcagatgaagcctaa

DBGET integrated database retrieval system