KEGG   Saccharomyces cerevisiae (budding yeast): YIL093CHelp
Entry
YIL093C           CDS       T00005                                 

Gene name
RSM25
Definition
(RefSeq) mitochondrial 37S ribosomal protein RSM25
  KO
K17402  small subunit ribosomal protein S23
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YIL093C (RSM25)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    YIL093C (RSM25)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MRP-S25 MRP-S23
Motif
Other DBs
NCBI-GeneID: 854715
NCBI-ProteinID: NP_012173
SGD: S000001355
UniProt: P40496
Position
IX:complement(187990..188784)
Genome map
AA seq 264 aa AA seqDB search
MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL
VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK
ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR
MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG
SWKDDTTLNTAQEEESTTSENLHF
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacaaacaaatgctgtaaacgtccttcaacggacgtccgcttacttgaaatca
ggattgttgaaagaaacacctgcgtggtacaacgttgtagcgtctatcccaccatcaacc
aagtttacacgtgaacctcgttttaagaatccttccaatggacacatcataggaaaactt
gttgacgtaacagaacaaccgcatgccaacaataagggactttacaagacaagacccaac
tcgagcgacaaaagggtgggcgtgaaaaggctgtacaggccacctaaactaacatacgtt
gaggataggctcagatcgctcttttacaaacaacatccatgggagttgtcgagacctaag
attttagtggaaaacgaaattggtgatgaaaactacgattggagccatatgcttcagata
ggaagaccactcgatggtgaaagtgttatccagcgaactatgtacttaatcaaaacgaag
cagtatggggacatggtcgaagcatatgaccatgccagatatgaattctatgcgttgaga
atgcaagaagaaacagagcagcaagtggctttggaagaagcggagatgttcggatccctc
tttggagtttctgccattgaacatggtatacaaaaggaacaagaggtcctagacgtctgg
gaaaagaaggtagttgaagaaactgaactaatggcagcaaggacaagtaaccctgcaggg
tcgtggaaggacgacactacattgaatacggcgcaagaagaagaatccaccacttccgag
aacctccacttctag

DBGET integrated database retrieval system