KEGG   Saccharomyces cerevisiae (budding yeast): YIL094CHelp
Entry
YIL094C           CDS       T00005                                 

Gene name
LYS12, LYS10, LYS11
Definition
(RefSeq) homoisocitrate dehydrogenase
  KO
K05824  homoisocitrate dehydrogenase [EC:1.1.1.87]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00300  Lysine biosynthesis
sce01100  Metabolic pathways
sce01130  Biosynthesis of antibiotics
sce01210  2-Oxocarboxylic acid metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00030  Lysine biosynthesis, AAA pathway, 2-oxoglutarate => 2-aminoadipate => lysine
sce_M00433  Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    YIL094C (LYS12)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.87  homoisocitrate dehydrogenase
     YIL094C (LYS12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 854714
NCBI-ProteinID: NP_012172
SGD: S000001356
UniProt: P40495
Position
IX:complement(186517..187632)
Genome map
AA seq 371 aa AA seqDB search
MFRSVATRLSACRGLASNAARKSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNFI
DLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGLF
ANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATRR
IATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNEQ
IVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHG
SAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAST
QQVVDDVLSRL
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtttagatctgttgctactagattatctgcctgccgtgggttagcatctaacgctgct
cgcaaatcactcactattggtcttatccccggtgacggtatcggtaaggaagtcattcct
gctggtaagcaagttttggaaaaccttaactccaagcacggcctaagcttcaactttatt
gatctctacgccggtttccaaacattccaagaaacaggaaaggcgttgcctgatgagact
gttaaagtgttgaaggaacaatgtcaaggtgctcttttcggtgcagttcagtctccaact
actaaggtggaaggttactcctcaccaattgttgctctaaggagggaaatgggccttttc
gctaatgttcgtcctgttaagtctgtagagggagaaaagggtaaaccaattgacatggtt
atcgtcagagaaaatactgaggacctgtacattaaaattgaaaaaacatacattgacaag
gccacaggtacaagagttgctgatgccacaaagagaatatccgaaattgcaacaagaaga
attgcaaccattgcattagatattgccttgaaaagattacaaacaagaggccaagccact
ttgacagtgactcataaatcaaatgttctatctcaaagtgatggtctattcagagaaatc
tgtaaggaagtctacgaatctaacaaggacaagtacggtcaaatcaaatataacgaacaa
attgtggattccatggtttataggctgttcagagaaccacaatgttttgatgtgatagtg
gcaccaaacctatacggggatatattatctgacggtgctgctgctttagtcggttcatta
ggtgttgttccaagcgccaacgtaggtccagaaattgtcattggtgaaccatgccatggt
tctgcaccagatattgctggtaaaggtattgctaacccaatcgccactataagatctact
gctttgatgttggaattcttgggccacaacgaagctgcccaagatatctacaaggctgtt
gatgctaacttaagagagggttctatcaagacaccagatttaggtggtaaggcttctact
caacaagtcgttgacgacgttttgtcgagattatag

DBGET integrated database retrieval system